| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.AGFAGDDAPR.A 6.68 0.14 488.7322 36.35 - 47.02 2 4.2E6 39.82 21 30 N
K.EITALAPSTMK.I 5.74 4.04 581.3179 64.83 - 71.78 2 3.6E6 67.69 318 328 N
R.AVFPSIVGRPR.H 2.24 6.42 400.2416 75.91 - 81.36 3 3.4E6 77.77 31 41 N
R.VAPEEHPTLLTEAPLNPK.A 4.50 2.58 652.6904 83.00 - 88.22 3 2.8E6 84.99 98 115 N
K.DSYVGDEAQSK.R 5.24 3.50 599.7699 31.97 - 41.34 2 2.4E6 34.53 53 63 N
R.HQGVMVGMGQK.D 4.45 0.30 586.2934 38.60 - 49.34 2 2.4E6 42.07 42 52 N
K.YPIE(+14.02)HGIITNWDDMEK.I 3.79 0.76 658.9835 102.80 - 107.55 3 1.9E6 104.73 71 86 N Methylation (DE)
R.AVFPSIVGRPR.H 4.14 0.34 599.8613 74.67 - 81.75 2 1.9E6 77.07 31 41 N
R.HQGVMVGMGQK.D 4.80 0.21 391.1979 38.61 - 49.54 3 1.7E6 42.23 42 52 N
R.AVFPSIVGR.P 4.90 1.24 473.2823 85.98 - 90.91 2 1.7E6 88.38 31 39 N
K.IIAPPER.K 5.09 6.75 398.2423 39.05 - 49.34 2 1.2E6 42.75 331 337 N
K.SYELPDGQVITIGNER.F 3.09 2.62 895.9534 102.80 - 109.77 2 1.1E6 105.98 241 256 N
K.RGILTLK.Y 5.40 2.22 400.7737 52.94 - 61.25 2 1.1E6 56.34 64 70 N
K.IWHHTFYNELR.V 3.14 1.52 505.9253 64.32 - 72.97 3 1.1E6 67.80 87 97 N
R.DLTDYLMK.I 4.29 4.37 499.7495 100.85 - 105.35 2 1E6 102.35 186 193 N
R.GILTLK.Y 3.65 0.89 644.4395 66.54 - 74.10 1 1E6 69.56 65 70 N
V.FPSIVGRPR.H 3.32 0.21 514.8076 74.74 - 81.72 2 7.9E5 77.00 33 41 N
K.SYELPDGQVITIGNER.F 3.62 1.21 597.6379 104.34 - 109.13 3 6.4E5 106.11 241 256 N
R.H(+43.01)QGVMVGMGQK.D 3.65 2.57 607.7964 48.44 - 58.56 2 6.3E5 51.84 42 52 N Carbamylation
K.ILTER.G 2.87 6.70 316.1939 31.59 - 38.22 2 4.6E5 33.25 194 198 N
K.YPIEHGIITNWDDMEK.I 3.18 2.02 980.9638 95.22 - 100.96 2 4.4E5 97.45 71 86 N
R.GYSFVTTAER.E 3.38 2.46 565.7820 62.10 - 69.22 2 4.3E5 64.85 199 208 N
R.HQ(+.98)GVMVGMGQK.D 1.19 0.20 586.7965 38.61 - 48.64 2 3.8E5 42.35 42 52 N Deamidation (NQ)
R.A(+43.01)VFPSIVGRPR.H 3.04 1.53 621.3630 98.75 - 103.11 2 3.1E5 100.72 31 41 N Carbamylation
K.DSYVGDEAQSKR.G 2.30 0.69 677.8200 29.92 - 36.86 2 3.1E5 32.47 53 64 N
L.TEAPLNPK.A 2.88 0.17 435.2426 32.88 - 42.14 2 2.9E5 35.76 108 115 N
R.KDLYANNVLSGGTTMYPGIADR.M 3.52 7.16 786.0628 96.65 - 101.47 3 2.7E5 98.46 293 314 N
K.DLYANNVLSGGTTMYPGIADR.M 1.03 0.48 743.3664 112.07 - 116.15 3 2.5E5 113.53 294 314 N
K.YPIE(+14.02)HGIITNWDDMEK.I 2.61 2.14 987.9726 102.90 - 107.74 2 2.4E5 104.71 71 86 N Methylation (DE)
K.AGFAGDDAPR.A 3.97 0.41 976.4540 36.35 - 46.93 1 2.4E5 39.80 21 30 N
K.IWHHTFYNELR.V 1.58 1.05 379.6946 64.35 - 73.37 4 2.4E5 68.08 87 97 N
K.DSYVGDEAQSKR.G 1.52 1.97 452.2188 30.71 - 38.64 3 2.2E5 32.66 53 64 N
F.PSIVGRPR.H 2.43 0.41 441.2728 74.64 - 81.36 2 2.2E5 77.14 34 41 N
K.DSYVGDEAQSK.R 3.25 0.24 1198.5318 31.97 - 41.44 1 2.1E5 34.62 53 63 N
R.VAPEEHPTLLTEAPLNPK.A 2.94 2.48 978.5301 82.73 - 87.98 2 2E5 84.91 98 115 N
K.IIAPPERK.Y 3.43 4.17 308.5287 32.43 - 42.01 3 1.6E5 35.26 331 338 N
R.G(+43.01)ILTLK.Y 3.51 6.63 687.4441 95.05 - 99.61 1 1.6E5 96.99 65 70 N Carbamylation
K.IWHHTFYNELR.V 0.96 1.42 758.3841 64.12 - 72.50 2 1.6E5 67.97 87 97 N
K.IKIIAPPER.K 2.98 2.47 346.2246 51.98 - 60.32 3 1.6E5 55.32 329 337 N
Y.ANNVLSGGTTMYPGIADR.M 2.55 0.45 918.9549 86.97 - 90.71 2 1.5E5 88.48 297 314 N
R.LDLAGR.D 1.98 3.17 644.3792 40.27 - 50.31 1 1.5E5 43.93 180 185 N
K.DLYANNVLSGGTTMYPGIADR.M 2.44 1.58 1114.5412 112.10 - 115.80 2 1.3E5 113.42 294 314 N
K.Q(-17.03)EYDEAGPSIVHR.K 2.33 2.52 742.3504 60.32 - 67.30 2 1.2E5 63.56 362 374 N Pyro-glu from Q
R.DLTDYLMK.I 2.39 3.71 998.4894 100.75 - 105.38 1 1.2E5 102.35 186 193 N
K.EITALAPSTMK.I 3.34 9.82 1161.6260 64.83 - 71.85 1 1.2E5 67.64 318 328 N
K.QEYDEAGPSIVHR.K 2.31 3.76 500.9119 46.71 - 56.03 3 1.1E5 50.40 362 374 N
Y.ANNVLSGGTTMYPGIADR.M 1.77 0.93 612.9745 87.07 - 91.10 3 1.1E5 88.53 297 314 N
K.IKIIAPPER.K 3.49 5.07 518.8331 51.95 - 60.32 2 1E5 55.31 329 337 N
V.FPSIVGRPR.H 2.77 0.34 343.5398 74.67 - 81.39 3 1E5 77.23 33 41 N
Y.ALPHAIMR.L 2.19 1.65 303.5109 46.10 - 55.93 3 1E5 49.80 172 179 N
F.YNELR.V 1.79 0.83 347.6812 30.96 - 37.51 2 9.7E4 32.80 93 97 N
K.IIAPPERK.Y 3.19 2.41 462.2904 32.50 - 41.71 2 9.6E4 35.26 331 338 N
R.HQGVMVGMGQK.D 3.12 1.06 1171.5766 38.64 - 49.01 1 9.5E4 42.05 42 52 N
K.IKIIAPPERK.Y 3.33 0.91 388.9226 42.50 - 52.28 3 9.2E4 46.39 329 338 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.56 1.19 668.6490 124.90 - 127.94 3 9.1E4 126.53 71 86 N Carbamylation
K.CDIDIR.K 1.35 0.71 367.6821 47.34 - 56.49 2 8.2E4 51.01 287 292 N
K.Q(-17.03)EYDEAGPSIVHRK.C 2.12 0.12 537.9343 49.44 - 58.46 3 8E4 53.08 362 375 N Pyro-glu from Q
K.I(+43.01)WHHTFYNELR.V 1.69 1.19 520.2610 105.64 - 111.13 3 6.8E4 107.63 87 97 N Carbamylation
K.A(+43.01)GFAGDDAPR.A 1.34 1.08 510.2372 49.09 - 55.35 2 6.5E4 52.40 21 30 N Carbamylation
K.C(+57.02)DIDIR.K 1.69 1.45 396.1941 42.45 - 51.78 2 6.2E4 45.95 287 292 N Carbamidomethylation
F.QQMWISK.Q 1.10 1.82 460.7397 53.74 - 62.81 2 6.1E4 57.50 355 361 N
R.AVFPSIVGRPR.H 0.14 5.94 599.8486 73.72 - 79.51 2 6E4 75.89 31 41 N
K.D(+43.01)SYVGDEAQSK.R 2.26 2.32 621.2725 39.12 - 49.90 2 5.5E4 43.02 53 63 N Carbamylation
R.HQGVM(+15.99)VGMGQK.D 1.63 0.11 594.2889 31.00 - 41.64 2 5.2E4 35.26 42 52 N Oxidation (M)
K.YPIE(+14.02)HGIITNWDDMEK.I 0.01 5.17 658.9848 103.30 - 107.61 3 5.1E4 104.70 71 86 N Methylation (DE)
H.GIITNWDDMEK.I 2.06 1.30 661.3147 94.98 - 98.75 2 5E4 96.35 76 86 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.18 2.47 1002.4672 124.78 - 128.22 2 4.7E4 126.58 71 86 N Carbamylation
K.QEYDEAGPSIVHRK.C 1.15 0.93 543.6101 38.67 - 46.12 3 4.7E4 42.73 362 375 N
R.G(+43.01)ILTLK.Y 2.36 3.08 344.2257 95.05 - 99.17 2 4.3E4 97.00 65 70 N Carbamylation
K.EITALAP(+31.99)STMK.I 1.21 1.34 597.3123 77.48 - 82.06 2 3.9E4 79.51 318 328 N Dihydroxylation [P]
K.IIAPPER.K 2.80 6.94 795.4768 39.02 - 49.20 1 3.7E4 42.74 331 337 N
R.V(+43.01)APEEHPTLLTEAPLNPK.A 1.94 2.68 667.0250 101.30 - 104.58 3 3.6E4 102.77 98 115 N Carbamylation
R.LDLAGR.D 0.72 1.65 644.3776 40.23 - 48.18 1 3.6E4 42.59 180 185 N
K.DLYANNVLSGGTTMYPGIADR.M 0.03 5.43 743.3506 113.13 - 117.04 3 3.4E4 113.79 294 314 N
K.CDIDIRK.D 0.76 0.41 431.7311 35.29 - 43.68 2 3.2E4 39.71 287 293 N
K.QEYDEAGPSIVHRK.C 0.93 0.53 407.9593 38.44 - 46.36 4 3.2E4 43.21 362 375 N
K.R(+43.01)GILTLK.Y 1.31 0.29 422.2747 72.00 - 77.89 2 3.1E4 74.52 64 70 N Carbamylation
R.MQKEITALAPSTMK.I 1.44 0.11 516.9457 64.08 - 68.49 3 3.1E4 66.78 315 328 N
K.D(+43.01)SYVGDEAQSKR.G 0.56 0.63 699.3282 35.27 - 44.74 2 3E4 38.77 53 64 N Carbamylation
K.IKIIAPPERK.Y 2.78 2.39 582.8806 42.47 - 52.35 2 2.9E4 46.39 329 338 N
Y.SFVTTAER.E 1.11 0.00 455.7374 40.95 - 50.87 2 2.8E4 45.26 201 208 N
K.C(+42.01)DIDIR.K 1.38 0.82 388.6927 52.62 - 61.18 2 2.8E4 56.14 287 292 N Acetylation (Protein N-term)
K.EITALAPSTMK.I 0.43 0.79 581.3080 67.45 - 75.08 2 2.6E4 70.63 318 328 N
K.DLYANNVLSGGTTMYPGIADR.M 0.09 2.10 743.3623 112.95 - 118.48 3 2.6E4 116.35 294 314 N
K.C(+43.01)DIDIR.K 1.04 0.83 389.1857 45.00 - 54.30 2 2.6E4 48.54 287 292 N Carbamylation
L.TEAPLNPK.A 2.04 0.17 869.4782 32.57 - 41.88 1 2.5E4 35.64 108 115 N
R.KDLYANNVLSGGTTMYPGIADR.M 2.06 2.68 1178.5902 96.76 - 100.53 2 2.4E4 98.43 293 314 N
K.EIT(-18.01)ALAPSTMK.I 0.93 0.09 572.3133 92.60 - 97.67 2 2.3E4 94.84 318 328 N Phospho neutral loss (ST)
R.LDLAGRDLTDYLMK.I 2.06 0.42 541.9556 117.51 - 120.61 3 2.2E4 118.86 180 193 N
L.SGGTTMYPGIADR.M 0.77 0.33 663.3188 58.35 - 63.19 2 2.1E4 60.92 302 314 N
K.YPIE(+14.02)HGIITNWDDMEK.I 0.02 5.25 987.9653 103.29 - 106.61 2 2E4 104.89 71 86 N Methylation (DE)
K.IWHHTFYNELR.V 0.13 1.27 758.3723 66.80 - 72.74 2 2E4 69.46 87 97 N
R.HQGVM(+15.99)VGMGQK.D 0.47 1.19 396.5294 33.29 - 42.04 3 2E4 35.40 42 52 N Oxidation (M)
R.LDLAGR.D 0.04 3.53 322.6865 41.58 - 48.98 2 1.9E4 43.85 180 185 N
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.29 2.22 866.1703 129.58 - 131.38 4 1.9E4 130.02 257 286 N Carbamidomethylation
K.E(+43.01)ITALAPSTMK.I 2.08 5.85 1204.6323 95.75 - 99.28 1 1.9E4 97.46 318 328 N Carbamylation
V.T(+42.01)TAER.E 0.84 3.12 619.2815 36.85 - 41.75 1 1.8E4 39.49 204 208 N Acetylation (Protein N-term)
S.KQEYDEAGPSIVHR.K 0.42 0.61 543.6093 42.05 - 48.02 3 1.8E4 45.31 361 374 N
R.A(+43.01)VFPSIVGRPR.H 2.11 0.63 414.5781 98.67 - 102.81 3 1.7E4 100.72 31 41 N Carbamylation
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.88 1.04 1038.4936 132.39 - 134.77 3 1.6E4 133.20 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.QEYDEAGPSIVHRK.C 1.26 1.67 814.9105 38.57 - 46.15 2 1.6E4 42.66 362 375 N
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.40 0.64 1053.4975 129.37 - 132.98 3 1.6E4 131.03 259 286 N Carbamidomethylation
K.SYE(+21.98)LPDGQVITIGNER.F 0.88 1.74 906.9437 104.73 - 108.35 2 1.6E4 106.19 241 256 N Sodium adduct
R.GILTLKYPIEHGIITNWDDMEK.I 0.74 0.81 647.3404 125.21 - 128.50 4 1.6E4 126.73 65 86 N
K.S(+43.01)YELPDGQVITIGNER.F 0.98 1.70 917.4540 118.78 - 123.41 2 1.6E4 121.26 241 256 N Carbamylation
K.YPIEHGIITNWDDMEK.I 0.69 0.52 654.2881 97.78 - 103.47 3 1.3E4 99.77 71 86 N
K.CD(+21.98)IDIR.K 1.31 8.05 378.6722 71.73 - 75.58 2 1.2E4 73.88 287 292 N Sodium adduct
K.I(+43.01)WHHTFYNELR.V 0.58 1.41 779.8864 105.88 - 111.05 2 1.1E4 107.56 87 97 N Carbamylation
K.EITALAPSTMK.I 0.06 2.53 581.3153 67.73 - 71.49 2 1.1E4 69.05 318 328 N
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 1.03 3.83 779.1187 132.08 - 133.69 4 1E4 132.62 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
R.A(+43.01)VFPSIVGRPR.H 0.05 3.17 621.3626 98.64 - 101.92 2 9.6E3 100.30 31 41 N Carbamylation
K.A(+42.01)GFAGDDAPR.A 0.02 5.08 509.7307 51.16 - 53.12 2 9.4E3 52.05 21 30 N Acetylation (Protein N-term)
R.MQKEITALAPSTMK.I 0.96 1.46 774.9152 64.04 - 68.83 2 9.4E3 66.63 315 328 N
C.D(+42.01)DDETTALVCDNGSGLVK.A Y 0.82 2.06 947.4308 95.41 - 101.15 2 9E3 97.79 3 20 Y Acetylation (Protein N-term)
L.ASLSTFQQMWISK.Q 0.55 0.17 763.8862 120.92 - 123.50 2 8.8E3 121.81 349 361 N
R.AVFPSIVGRPR.H 0.03 4.87 400.2442 78.90 - 83.75 3 8.4E3 80.46 31 41 N
Y.VALDFENEMATAASSSSLEK.S 0.76 0.60 1050.4997 112.30 - 115.95 2 8.2E3 113.49 221 240 N
R.M(+43.01)QKEITALAPSTMK.I 0.82 1.20 796.4156 84.19 - 86.66 2 8.2E3 85.36 315 328 N Carbamylation
R.GILTLKYPIE(+14.02)HGIITNWDDMEK.I 0.94 0.71 650.8458 128.42 - 129.43 4 8.1E3 128.86 65 86 N Methylation (DE)
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.95 0.62 1048.8271 127.47 - 132.02 3 7.9E3 131.13 259 286 N Carbamylation
R.D(+43.01)LTDYLMK.I 1.04 2.72 521.2535 117.27 - 119.05 2 7.9E3 118.11 186 193 N Carbamylation
R.V(+43.01)APEEHPTLLTEAPLNPK.A 0.56 1.92 1000.0326 101.50 - 104.49 2 7.8E3 102.85 98 115 N Carbamylation
R.F(+43.01)RCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.45 0.08 862.6653 129.90 - 131.59 4 7.7E3 130.32 257 286 N Carbamylation
K.IKIIAPPER.K 0.03 5.28 346.2187 54.80 - 55.73 3 7.1E3 55.22 329 337 N
R.G(+43.01)YSFVTTAER.E 0.30 1.41 587.2946 84.31 - 88.66 2 7E3 86.20 199 208 N Carbamylation
K.QEYDEAGPSIVHR.K 0.02 5.37 500.9013 48.98 - 50.81 3 6.4E3 49.86 362 374 N
R.GILTLKYPIEHGIITNWDDMEK.I 1.05 1.00 862.7833 125.34 - 127.43 3 6.3E3 126.55 65 86 N
R.HQGVMVGMGQK.D 1.50 1.49 391.1940 106.34 - 110.45 3 6.2E3 108.20 42 52 N
K.I(+43.01)IAPPER.K 0.23 7.18 419.7466 71.57 - 74.74 2 6E3 73.51 331 337 N Carbamylation
Y.ANNVLSGGTTMYPGIADR.M 0.68 0.71 918.9250 85.10 - 90.28 2 5.5E3 87.35 297 314 N
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.33 1.42 1053.4985 130.80 - 134.51 3 5.4E3 131.65 259 286 N Carbamidomethylation
R.LDLAGRDLTDYLMK.I 0.56 2.60 812.4276 117.64 - 119.71 2 5.4E3 118.77 180 193 N
K.YPIE(+14.02)HGIITNWDDMEK.I 0.23 0.40 658.9872 95.97 - 98.66 3 5E3 97.27 71 86 N Methylation (DE)
R.D(+43.01)LTDYLMK.I 0.86 1.51 1041.4964 116.87 - 121.52 1 4.9E3 118.27 186 193 N Carbamylation
K.LC(+57.02)YVALDFENEMATAASSSSLEK.S 0.42 1.21 846.0626 128.85 - 132.28 3 4.7E3 131.05 218 240 N Carbamidomethylation
K.IK(+43.01)IIAPPER.K 1.06 0.09 360.5600 52.94 - 60.32 3 4.5E3 55.24 329 337 N Carbamylation
R.MQK(+43.01)EITALAPSTMK.I 0.08 1.58 531.2757 83.22 - 86.20 3 4.3E3 84.75 315 328 N Carbamylation
L.STFQQMWISK.Q 0.05 1.72 628.3135 94.45 - 97.31 2 4.3E3 95.84 352 361 N
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 0.19 0.97 1034.4917 130.99 - 133.49 3 4.1E3 131.94 259 286 N
R.K(+43.01)DLYANNVLSGGTTMYPGIADR.M 0.40 3.21 800.3953 109.42 - 111.58 3 3.8E3 110.72 293 314 N Carbamylation
K.D(+42.01)LYANNVLSGGTTMYPGIADR.M 0.26 0.44 568.2618 115.47 - 117.74 4 3.8E3 116.55 294 314 N Acetylation (Protein N-term)
K.D(+43.01)LYANNVLSGGTTMYPGIADR.M 0.17 4.08 757.7011 125.93 - 127.80 3 3.7E3 126.53 294 314 N Carbamylation
K.QEYDEAGPSIVHRK.C 0.22 2.74 814.9119 40.29 - 47.99 2 3.5E3 45.15 362 375 N
R.HQGVMVGMGQK(+43.01)DSYVGDEAQSK.R 0.13 0.09 798.7041 67.69 - 70.02 3 3.2E3 68.60 42 63 N Carbamylation
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.22 0.59 790.3789 130.81 - 131.89 4 3.2E3 131.14 259 286 N Carbamidomethylation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.65 0.26 1135.5475 130.75 - 133.44 3 3.1E3 131.31 257 286 N
K.DLYANNVLS(-18.01)GGTTMYPGIADR.M 0.04 3.56 737.3672 115.20 - 117.88 3 3E3 116.41 294 314 N Phospho neutral loss (ST)
K.C(+43.01)(+45.99)DIDIR.K 0.42 0.87 412.1790 48.64 - 52.55 2 2.7E3 50.91 287 292 N Carbamylation; Beta-methylthiolation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.09 0.08 851.9174 130.76 - 131.91 4 2.7E3 131.30 257 286 N
K.LCYVALDFENEMATAASSSSLEK.S 0.03 0.76 827.0469 130.83 - 134.27 3 2.6E3 132.07 218 240 N
R.G(+43.01)ILTLK.Y 0.50 2.02 344.2255 92.57 - 99.17 2 2.4E3 94.70 65 70 N Carbamylation
R.AVFPSIVGRPR.H 0.01 2.28 599.8615 74.47 - 80.16 2 2.4E3 77.78 31 41 N
K.SYELPDGQVITIGNER.F 0.02 5.35 597.6383 95.83 - 99.51 3 2.2E3 97.80 241 256 N
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.05 5.43 779.1227 133.01 - 133.76 4 2.2E3 133.21 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.IWHHTFYNELR.V 0.07 0.42 379.6933 68.64 - 78.73 4 2.2E3 71.12 87 97 N
K.S(+43.01)YELPDGQVITIGNER.F 0.06 5.39 917.4686 119.06 - 122.81 2 2E3 121.35 241 256 N Carbamylation
R.M(+43.01)QKEITALAPSTMK.I 0.01 5.13 531.2851 84.14 - 86.72 3 1.7E3 85.66 315 328 N Carbamylation
K.I(+43.01)LTER.G 0.16 0.95 337.6988 71.13 - 74.54 2 1.5E3 72.73 194 198 N Carbamylation
K.D(+21.98)LYANNVLSGGTTM(+15.99)YPGIADR.M 0.09 1.73 567.2584 112.72 - 114.21 4 1.3E3 113.42 294 314 N Sodium adduct; Oxidation (M)
K.EITALAPSTMK(+43.01)IK.I 0.49 2.66 482.6088 90.48 - 91.56 3 1.1E3 90.98 318 330 N Carbamylation
R.HQGVMVGM(+15.99)GQK.D 0.08 0.38 594.2728 27.67 - 31.05 2 894.6 28.52 42 52 N Oxidation (M)
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.01 2.60 1048.8142 131.05 - 132.02 3 791 131.49 259 286 N Carbamylation
K.DLYANN(+.98)VLSGGTTMYPGIADR.M 0.01 0.46 743.6959 112.45 - 116.13 3 643.8 114.70 294 314 N Deamidation (NQ)
K.SYELPDGQVITIGNER.F 0.00 0.23 895.9610 95.01 - 99.56 2 506.2 97.76 241 256 N
R.MQK(+43.01)EITALAPSTMK.I 0.01 0.48 796.4299 82.19 - 87.28 2 485.3 84.98 315 328 N Carbamylation
K.DLYANNVLSGGTTMYPGIADR.M 0.04 2.08 1114.5408 110.32 - 115.72 2 351 111.85 294 314 N
total 166 peptides