| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
R.ALDTMNFDVIK.G 2.13 1.81 633.8271 105.21 - 109.51 2 7.9E4 107.42 68 78 N
K.SGVGNIFIK.N 2.50 1.11 467.7742 81.61 - 86.76 2 7.6E4 83.92 96 104 N
R.GFGFVSFER.H 2.30 0.12 523.2620 106.98 - 111.53 2 6.6E4 108.90 232 240 N
R.IVATKPLYVALAQR.K 2.50 0.91 514.9871 85.28 - 89.90 3 6.6E4 87.41 357 370 N
K.MNGMLLNDR.K 1.55 0.01 532.2586 63.91 - 70.88 2 5.8E4 66.85 158 166 N
R.YQGVNLYVK.N 1.67 0.50 542.2991 68.70 - 74.42 2 4.8E4 71.09 291 299 N
R.SKVDEAVAVLQAHQAK.E 1.37 1.24 565.3158 66.16 - 72.09 3 3.2E4 68.73 608 623 N
R.LFPLIQNMHPSLTGK.I 1.68 0.21 565.9816 117.13 - 121.62 3 3E4 119.34 569 583 N
R.IMWSQR.D 1.34 0.55 410.7131 50.15 - 59.13 2 2.9E4 53.54 84 89 N
K.NFGEDMDEEK.L 2.00 0.77 607.2434 45.07 - 51.75 2 2.1E4 48.38 197 206 N
K.EFTNVYVK.N 1.34 1.26 500.2634 58.15 - 65.85 2 2.1E4 61.26 189 196 N
R.Q(-17.03)AHLTNQYMQR.M 1.25 0.58 686.8295 51.49 - 57.48 2 2.1E4 54.84 375 385 N Pyro-glu from Q
K.EFTPFGTITSAK.V 1.44 0.15 649.8380 98.06 - 102.32 2 1.9E4 99.87 313 324 N
K.GFGFVCFSSPEEATK.A 1.40 1.79 803.3699 119.76 - 123.26 2 1.8E4 121.25 334 348 N
R.IVATKPLYVALAQR.K 2.02 1.31 771.9755 85.28 - 89.87 2 1.5E4 87.45 357 370 N
R.EAELGAR.A 0.85 0.60 745.3913 27.83 - 35.30 1 1.5E4 31.37 180 186 N
R.SLGYAYVNFQQPADAER.A 1.69 1.03 964.9652 92.94 - 96.80 2 1.4E4 94.57 51 67 N
R.QAHLTNQYMQR.M 1.44 0.53 695.3417 37.65 - 48.51 2 1.4E4 41.89 375 385 N
Y.VGDLHQDVTEAMLYEK.F 1.12 1.88 616.6366 88.70 - 92.55 3 1.3E4 90.12 15 30 N
R.SLGYAYVNFQQPADAER.A 0.67 0.14 643.6465 93.22 - 96.50 3 1.2E4 94.48 51 67 N
P.EEATK.A 0.31 5.16 577.2762 29.52 - 34.11 1 1.2E4 30.86 344 348 N
F.SAFGNILSCK(+43.01).V 0.67 3.21 541.7731 86.28 - 92.90 2 1.1E4 88.48 120 129 N Carbamylation
K.NLDDGIDDER.L 0.42 2.35 581.2632 44.80 - 53.96 2 1.1E4 48.03 300 309 N
R.DMITR.R 0.19 2.41 318.1639 29.13 - 39.64 2 1E4 34.39 45 49 N
Y.AYVNFQQPADAER.A 0.77 0.60 754.8664 63.30 - 69.39 2 1E4 66.06 55 67 N
K.YGNAMSIR.V 0.08 1.23 456.2279 44.44 - 48.67 2 8.3E3 46.31 214 221 N
K.FSPAGAILSIR.V 1.34 0.95 566.3328 111.41 - 115.20 2 8.1E3 113.26 31 41 N
R.KEFTPFGTITSAK.V 0.70 0.18 476.2614 82.15 - 87.11 3 8.1E3 84.07 312 324 N
K.G(+43.01)FGFVCFSSPEEATK.A 0.39 3.31 824.8763 115.65 - 119.65 2 5.3E3 117.45 334 348 N Carbamylation
R.EAELGAR.A 0.06 0.43 373.1950 23.25 - 31.39 2 4.8E3 29.04 180 186 N
R.ALDTMNFDVIK.G 0.13 1.46 633.8316 104.08 - 107.27 2 4.5E3 105.25 68 78 N
K.YAAGVR.N 0.12 0.48 318.6814 29.60 - 34.16 2 4.1E3 31.64 517 522 N
R.SKVDEAVAVLQAHQAK.E 0.15 0.88 424.2402 66.41 - 69.75 4 4E3 68.39 608 623 N
K.GFGFVCFSSPEEATK.A 0.29 0.15 803.3520 115.42 - 122.08 2 3.3E3 118.15 334 348 N
K.MNGMLLNDRK.V 0.04 5.69 397.8770 50.09 - 53.76 3 2.6E3 52.03 158 167 N
R.LFPLIQNMHPSLTGK.I 0.02 3.55 565.9831 118.39 - 119.71 3 1.7E3 119.07 569 583 N
R.NPQQHMPAQPVPMQQPAVHVQGQEPLTASMLAAAPPQEQK.Q Y 0.46 8.50 1078.3036 98.75 - 101.02 4 1.6E3 100.12 523 562 Y
K.ALYDTFSAFGNILSCK.V 0.24 1.09 875.4329 134.05 - 136.45 2 1.6E3 135.05 114 129 N
R.SKVDEAVAVLQAHQAK.E 0.00 5.02 565.3123 65.69 - 72.09 3 1.2E3 69.01 608 623 N
K.GFGFVCFSSPEEATK.A 0.09 0.98 803.3833 118.01 - 122.64 2 899.5 121.26 334 348 N
Y.VGDLHQDVTEAMLYEK.F 0.00 5.14 616.6390 88.71 - 90.50 3 665.4 89.22 15 30 N
total 41 peptides