| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
R.VFVVGQYRPAGNMNMPGYFEK.N 2.24 13.82 802.0614 107.06 - 112.06 3 2.7E5 109.32 123 143 N
M.A(+42.01)DASFQEEFLETHNAYR.A Y 2.58 9.87 690.6485 106.31 - 112.41 3 1.6E5 108.03 2 18 Y Acetylation (Protein N-term)
K.WSSPGFQSDTGHFTQVVWK.D 1.21 17.18 732.0231 103.53 - 109.77 3 1.1E5 107.92 89 107 N
K.EAVDSWYSEIK.D 1.92 3.90 663.8199 90.76 - 95.69 2 1.1E5 92.60 75 85 N
M.A(+42.01)DASFQEEFLETHNAYR.A Y 2.06 40.10 1035.4694 106.31 - 111.87 2 9.8E4 108.14 2 18 Y Acetylation (Protein N-term)
K.DSTELGVGLATDGKR.V 1.06 2.98 506.9327 60.66 - 69.98 3 9.6E4 63.44 108 122 N
R.VFVVGQ(+.98)YRPAGNMNMPGYFEK.N 0.37 6.67 802.3985 106.39 - 111.32 3 8.5E4 108.92 123 143 N Deamidation (NQ)
K.WADQLLATNTMQHSETADGENIYGMSSSAPIKPTGK.E 2.21 2.01 963.2109 103.04 - 107.61 4 6.6E4 105.18 39 74 N
K.NVCPLA 0.51 0.07 616.3147 63.63 - 71.93 1 6.5E4 66.71 144 149 N
K.EAVDSWYSEIKDYK.W 1.24 14.82 578.2807 96.87 - 100.93 3 6.4E4 98.34 75 88 N
K.DSTELGVGLATDGK.R 1.15 2.90 681.8491 69.93 - 76.72 2 5.3E4 72.43 108 121 N
K.DSTELGVGLATDGKR.V 0.60 2.48 759.8917 60.62 - 67.70 2 5E4 63.73 108 122 N
Q.ELTASAQK.W 0.90 10.36 424.2351 28.38 - 30.50 2 4.7E4 29.11 31 38 N
R.PAGNMNMPGYFEK.N 1.85 2.44 728.3283 79.23 - 84.27 2 4E4 81.16 131 143 N
K.MTLNQELTASAQK.W 0.96 1.17 478.9160 68.11 - 75.24 3 3.1E4 70.92 26 38 N
K.EAVDSWYSEIKDYK.W 1.00 17.59 866.9154 94.98 - 99.72 2 2.6E4 97.89 75 88 N
K.EAVDSWYSEIKDY.K 1.15 6.26 802.8672 110.27 - 115.80 2 2E4 113.38 75 87 N
K.DSTELGVGLAT(-18.01)DGKR.V 0.88 10.68 750.8940 61.89 - 66.20 2 1.8E4 64.24 108 122 N Phospho neutral loss (ST)
K.NVC(+57.02)PLA 0.32 2.27 673.3362 48.86 - 57.49 1 1.8E4 52.09 144 149 N Carbamidomethylation
R.VFVVGQYRPAGNMNMPGYFEK.N 1.75 9.26 1202.5883 107.06 - 111.79 2 1.6E4 109.26 123 143 N
K.WADQLLATNTMQHSETADGENIYGMSSSAPIKPTGK.E 1.73 6.59 1283.9466 103.04 - 107.24 3 1.4E4 105.17 39 74 N
R.VFVVGQYRPAGNMNMPGYFEK.N 0.68 3.22 601.8004 107.04 - 111.35 4 1.3E4 109.29 123 143 N
K.WADQLLATNTMQHSETADGENIYGMSSSAPIKPTGK.E 0.68 3.63 770.7737 102.97 - 107.23 5 1.2E4 105.31 39 74 N
K.WADQLLATNTMQHSET(-18.01)ADGENIYGMSSSAPIKPTGK.E 0.91 6.16 958.7102 104.06 - 107.86 4 1.2E4 105.98 39 74 N Phospho neutral loss (ST)
K.DSTELGVGLAT(-18.01)DGKR.V 0.63 8.67 500.9319 61.82 - 66.95 3 1.2E4 64.53 108 122 N Phospho neutral loss (ST)
Y.GMSSSAPIKPTGK.E 0.58 3.03 630.8384 33.47 - 43.28 2 1E4 36.55 62 74 N
R.V(+43.01)FVVGQYRPAGNMNMPGYFEK.N 0.93 4.25 816.3986 129.82 - 131.00 3 9.6E3 130.30 123 143 N Carbamylation
K.WSSPGFQSDTGHFTQVVWK.D 0.74 9.17 1097.5333 106.87 - 109.67 2 8.6E3 108.09 89 107 N
K.MTLNQELTASAQK.W 0.40 1.47 717.8666 70.79 - 82.37 2 8.1E3 77.51 26 38 N
K.MTLNQELTASAQK.W 0.14 4.28 717.8700 71.25 - 79.43 2 8.1E3 74.28 26 38 N
K.MTLNQELTASAQK.W 0.02 2.48 717.8731 67.38 - 74.93 2 7.1E3 69.10 26 38 N
Y.GMSSSAPIKPTGK.E 0.23 0.01 420.8948 34.26 - 43.44 3 7.1E3 37.65 62 74 N
H.SETADGENIYGMSSSAPIKPTGK.E 0.23 0.94 780.7053 69.63 - 74.17 3 5E3 71.66 52 74 N
K.EAVDSWYSEIKDYK.W 0.04 3.78 578.2581 96.30 - 100.06 3 4.7E3 97.66 75 88 N
M.A(+42.01)DASFQEEFLETHNAYR.A Y 0.30 2.61 1035.4708 108.03 - 113.11 2 4.6E3 110.35 2 18 Y Acetylation (Protein N-term)
K.NVC(+57.02)PLA 0.84 10.56 337.1746 49.44 - 53.77 2 2.9E3 51.70 144 149 N Carbamidomethylation
N.MNMPGYFEK.N 1.03 4.15 558.7536 78.98 - 82.85 2 2.9E3 80.95 135 143 N
D.ASFQEEFLETHNAYR.A 0.15 5.67 614.6286 88.78 - 90.61 3 2.6E3 89.81 4 18 N
K.E(+43.01)AVDSWYSEIKDYK.W 0.11 1.87 888.4132 117.72 - 123.52 2 2.1E3 120.15 75 88 N Carbamylation
K.WADQLLATNTMQH.S 0.03 5.26 764.8737 91.88 - 93.91 2 2E3 92.88 39 51 N
K.WADQLLAT(-18.01)NTMQHSETADGENIYGMSSSAPIKPTGK.E 0.09 2.30 958.6968 103.58 - 107.86 4 1.8E3 106.04 39 74 N Phospho neutral loss (ST)
K.EAVDSWYSEIKDY.K 0.18 2.48 802.8549 109.14 - 114.42 2 1.7E3 110.88 75 87 N
K.W(+43.01)ADQLLATNTMQHSETADGENIYGMSSSAPIKPTGK.E 0.41 8.02 973.9704 127.28 - 128.36 4 1.2E3 127.76 39 74 N Carbamylation
M.A(+42.01)DASFQEEFLETHNAYR.A Y 0.05 4.70 1035.4732 104.72 - 110.40 2 661.3 106.71 2 18 N Acetylation (Protein N-term)
total 44 peptides