| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
R.ALDTMNFDVIK.G 2.07 4.04 633.8271 105.21 - 109.51 2 5.1E4 107.42 68 78 N
K.SGVGNIFIK.N 2.48 3.54 467.7742 81.61 - 86.76 2 4.9E4 83.92 96 104 N
R.GFGFVSFER.H 2.30 6.00 523.2620 106.98 - 111.53 2 4.3E4 108.90 232 240 N
R.IVATKPLYVALAQR.K 2.47 6.69 514.9871 85.28 - 89.90 3 4.3E4 87.41 357 370 N
K.MNGMLLNDR.K 1.51 1.94 532.2586 63.91 - 70.88 2 3.8E4 66.85 158 166 N
R.YQGVNLYVK.N 1.63 5.01 542.2991 68.70 - 74.42 2 3.1E4 71.09 291 299 N
R.SKVDEAVAVLQAHQAK.E 1.38 4.46 565.3158 66.16 - 72.09 3 2.1E4 68.73 608 623 N
R.LFPLIQNMHPSLTGK.I 1.67 5.33 565.9816 117.13 - 121.62 3 1.9E4 119.34 569 583 N
R.IMWSQR.D 1.36 4.78 410.7131 50.15 - 59.13 2 1.9E4 53.54 84 89 N
K.NFGEDMDEEK.L 2.00 8.02 607.2434 45.07 - 51.75 2 1.4E4 48.38 197 206 N
K.EFTNVYVK.N 1.35 3.01 500.2634 58.15 - 65.85 2 1.4E4 61.26 189 196 N
R.Q(-17.03)AHLTNQYMQR.M 1.22 3.90 686.8295 51.49 - 57.48 2 1.4E4 54.84 375 385 N Pyro-glu from Q
K.EFTPFGTITSAK.V 1.42 3.31 649.8380 98.06 - 102.32 2 1.2E4 99.87 313 324 N
K.GFGFVCFSSPEEATK.A 1.41 6.26 803.3699 119.76 - 123.26 2 1.2E4 121.25 334 348 N
R.IVATKPLYVALAQR.K 1.99 4.50 771.9755 85.28 - 89.87 2 9.8E3 87.45 357 370 N
R.SLGYAYVNFQQPADAER.A 1.73 3.73 964.9652 92.94 - 96.80 2 9.4E3 94.57 51 67 N
R.EAELGAR.A 0.89 0.34 745.3904 27.83 - 35.30 1 9.3E3 31.07 180 186 N
R.QAHLTNQYMQR.M 1.44 3.66 695.3417 37.65 - 48.51 2 8.8E3 41.89 375 385 N
Y.VGDLHQDVTEAMLYEK.F 1.13 1.85 616.6366 88.70 - 92.55 3 8.4E3 90.12 15 30 N
R.EAELGAR.A 0.36 2.58 373.1962 20.67 - 31.70 2 8.3E3 29.17 180 186 N
R.SLGYAYVNFQQPADAER.A 0.68 1.38 643.6465 93.22 - 96.50 3 7.6E3 94.48 51 67 N
R.KFEQMK.Q 0.20 0.46 405.7162 29.76 - 31.63 2 6.7E3 30.73 279 284 N
P.EEATK.A 0.28 0.91 577.2783 29.52 - 34.11 1 6.7E3 30.81 344 348 N
Y.AYVNFQQPADAER.A 0.78 0.32 754.8664 63.30 - 69.39 2 6.6E3 66.06 55 67 N
R.DMITR.R 0.17 1.53 318.1637 33.06 - 39.64 2 6.1E3 34.86 45 49 N
R.EAELGAR.A 0.09 1.36 373.1987 30.85 - 40.44 2 5.9E3 34.60 180 186 N
K.YGNAMSIR.V 0.08 5.47 456.2279 44.44 - 48.67 2 5.4E3 46.31 214 221 N
K.FSPAGAILSIR.V 1.31 1.53 566.3328 111.41 - 115.20 2 5.3E3 113.26 31 41 N
R.KEFTPFGTITSAK.V 0.69 3.91 476.2614 82.15 - 87.11 3 5.3E3 84.07 312 324 N
K.GFGFVCFSSPEEATK(+43.01).A 0.40 3.06 824.8763 115.65 - 119.65 2 3.4E3 117.45 334 348 N Carbamylation
R.ALDTMNFDVIK.G 0.13 1.27 633.8316 104.08 - 107.27 2 2.9E3 105.25 68 78 N
R.SKVDEAVAVLQAHQAK.E 0.12 6.03 424.2402 66.41 - 69.75 4 2.6E3 68.39 608 623 N
K.YAAGVR.N 0.10 0.65 318.6793 29.60 - 33.51 2 2.5E3 31.13 517 522 N
F.SAFGNILSCK(+43.01).V 0.18 5.22 541.7751 86.28 - 89.21 2 2.5E3 87.94 120 129 N Carbamylation
K.GFGFVCFSSPEEATK.A 0.21 0.39 803.3570 117.59 - 122.08 2 1.9E3 119.21 334 348 N
K.MNGMLLNDRK.V 0.04 5.41 397.8770 50.09 - 53.76 3 1.7E3 52.03 158 167 N
R.LFPLIQNMHPSLTGK.I 0.02 5.14 565.9831 118.39 - 119.71 3 1.1E3 119.07 569 583 N
R.NPQQHMPAQPVPMQQPAVHVQGQEPLTASMLAAAPPQEQK.Q Y 0.41 7.74 1078.3036 98.75 - 101.02 4 1E3 100.12 523 562 Y
K.ALYDTFSAFGNILSCK.V 0.24 1.83 875.4329 134.05 - 136.45 2 1E3 135.05 114 129 N
R.SKVDEAVAVLQAHQAK.E 0.00 5.13 565.3123 65.69 - 72.09 3 772.5 69.01 608 623 N
K.GFGFVCFSSPEEATK.A 0.08 5.63 803.3848 119.68 - 123.85 2 576.7 121.77 334 348 N
Y.VGDLHQDVTEAMLYEK.F 0.00 5.06 616.6390 88.71 - 90.50 3 431.8 89.22 15 30 N
total 42 peptides