| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
Y.MVGPIEEVVLK.A Y 3.65 5.25 607.3500 103.73 - 108.02 2 2.4E5 105.63 512 522 Y
R.IPVGPETLGR.I Y 3.77 4.75 519.8036 63.30 - 70.63 2 1.8E5 66.18 137 146 Y
R.TIAMDGTEGLVR.G Y 3.29 6.93 631.8291 73.80 - 78.88 2 1.7E5 75.67 113 124 Y
R.IMDPNIVGTEHYEIAR.G Y 1.94 3.81 619.9817 82.63 - 87.59 3 1.5E5 84.63 410 425 N
R.IMNVIGEPIDER.G Y 2.56 2.76 693.3639 85.10 - 89.57 2 1.3E5 87.07 147 158 N
K.ILQDYK.S Y 2.16 5.87 390.2207 36.33 - 46.13 2 9E4 39.54 430 435 N
K.VLDTGAPIRIPVGPETLGR.I Y 2.51 26.22 654.3814 106.81 - 110.94 3 8.8E4 108.95 128 146 N
K.VVDLLAPYAK.G Y 2.61 34.06 544.8238 97.07 - 101.12 2 8E4 98.79 192 201 N
R.FLSQPFQVAEVFTGHMGK.L Y 2.71 44.70 675.0117 130.84 - 132.55 3 6.4E4 131.48 466 483 N
K.IGLFGGAGVGK.T Y 2.03 18.82 488.2879 85.56 - 90.81 2 6.1E4 87.72 205 215 N
R.FTQAGSEVSALLGR.I Y 1.73 8.04 718.3841 99.13 - 103.62 2 6.1E4 101.64 314 327 N
K.VALVYGQMNEPPGAR.A Y 1.99 17.32 801.4123 74.11 - 79.49 2 6E4 76.38 268 282 N
R.LVLEVAQHLGENTVR.T Y 2.34 8.13 559.9837 90.63 - 95.73 3 4.9E4 92.33 98 112 N
Y.VAPAAAVTVAAGR.I Y 1.91 19.17 577.3417 51.36 - 59.62 2 4.7E4 54.73 53 65 N
R.IPSAVGYQPTLATDMGTMQER.I Y 1.37 12.72 756.0348 99.25 - 102.24 3 4.2E4 100.53 328 348 N
R.IMNVIGEPIDERGPISTK.H Y 1.89 18.78 657.0235 89.49 - 93.23 3 3.8E4 91.01 147 164 N
R.IMDPNIVGTEHY.E Y 2.14 1.20 694.8326 80.09 - 84.58 2 3.3E4 81.90 410 421 N
R.AIAELGIYPAVDPLDSTSR.I Y 2.63 14.25 663.3529 123.97 - 127.01 3 3.2E4 125.43 391 409 N
R.VALTGLSVAEYFR.D Y 2.25 22.24 713.3934 128.61 - 129.90 2 3E4 129.19 285 297 N
K.ILQDYK.S Y 2.55 6.23 779.4346 36.58 - 46.10 1 2.3E4 39.64 430 435 N
R.AIAELGIYPAVDPLDSTSR.I Y 2.45 7.04 994.5244 123.98 - 127.03 2 2.1E4 125.42 391 409 N
K.I(+43.01)GLFGGAGVGK(+43.01).T Y 0.31 7.49 531.2914 40.27 - 47.08 2 1.8E4 43.88 205 215 N Carbamylation
K.LVPLKETIK.G Y 1.48 20.01 347.5637 51.81 - 56.98 3 1.5E4 55.15 484 492 N
R.LVLEVAQHLGENTVR.T Y 2.32 9.89 839.4739 90.60 - 94.31 2 1.5E4 92.33 98 112 N
F.AHLDATTVLSR.A Y 0.64 0.84 395.2197 58.30 - 65.11 3 1.4E4 60.84 380 390 N
R.IPSAVGYQPTLATDMGTMQER.I Y 1.92 13.59 1133.5519 99.10 - 102.75 2 1.2E4 100.55 328 348 N
R.FTQAGSEVSALLGR.I Y 1.33 6.24 479.2609 99.08 - 103.65 3 1.2E4 101.63 314 327 N
R.EGNDLYHEMIESGVINLK.D Y 1.31 1.17 687.6729 124.26 - 127.23 3 1.1E4 125.67 245 262 N
K.LVPLKETIK.G Y 1.34 18.90 520.8444 51.78 - 56.94 2 1.1E4 55.09 484 492 N
R.IPSAVGYQPTLATDMGTMQER.I Y 0.19 6.06 756.0194 98.45 - 101.09 3 9.2E3 99.63 328 348 N
R.EGNDLYHEMIESGVINLKDDTSK.V Y 0.79 7.50 652.5654 117.77 - 119.80 4 6.4E3 118.78 245 267 N
K.TVLIMELINNVAK.A Y 1.49 10.02 729.4288 133.71 - 136.18 2 5.9E3 135.73 216 228 N
K.HTAPIHAEAPEFTDMSVEQEILVTGIK.V Y 0.09 5.64 741.6301 124.66 - 127.35 4 5.8E3 125.82 165 191 N
R.TREGNDLYHEMIESGVINLKDDTSK.V Y 0.28 6.02 716.8533 109.05 - 112.12 4 5.5E3 110.63 243 267 N
R.T(+43.01)IAMDGTEGLVR.G Y 0.29 1.17 653.3309 93.95 - 96.91 2 5.5E3 95.31 113 124 N Carbamylation
R.FTQAGSEVSALLGR.I Y 0.12 0.35 718.3815 98.95 - 103.62 2 5.1E3 101.01 314 327 N
Y.VAPAAAVTVAAGR.I Y 0.18 6.28 385.2310 51.93 - 57.33 3 3.6E3 55.04 53 65 N
R.IMNVIGEPIDER.G Y 0.51 0.93 462.5764 85.14 - 89.47 3 3.4E3 86.95 147 158 N
R.VALTGLSVAEYFR.D Y 1.10 7.83 475.9327 128.29 - 129.63 3 3.1E3 129.12 285 297 N
Y.M(+43.01)VGPIEEVVLK.A Y 0.82 0.07 628.8546 132.43 - 133.77 2 3E3 133.13 512 522 N Carbamylation
K.IGLFGGAGVGK.T Y 0.05 2.60 488.2804 85.82 - 89.78 2 2.9E3 88.12 205 215 N
R.AIAELGIYPAVD(+21.98)PLDSTSR.I Y 0.60 1.64 670.6788 124.42 - 126.64 3 2.9E3 125.48 391 409 N Sodium adduct
R.EGNDLYHEMIESGVINLKDDTSK.V Y 0.68 3.96 869.7518 117.74 - 120.75 3 2.9E3 118.93 245 267 N
K.VVDLLAPYAK.G Y 1.63 35.81 1088.6414 97.07 - 99.86 1 2.5E3 98.64 192 201 N
R.FLSQPFQVAEVFTGHMGK.L Y 0.77 7.46 1012.0185 130.81 - 131.92 2 2.2E3 131.40 466 483 N
R.IMNVIGEPIDER.G Y 0.02 5.12 693.3665 85.90 - 87.55 2 2E3 86.90 147 158 N
R.IMNVIGEPIDERGPISTK.H Y 0.74 9.02 985.0314 89.62 - 92.00 2 2E3 90.71 147 164 N
K.VALVYGQMN(+.98)EPPGAR.A Y 0.05 5.61 534.9482 75.40 - 77.70 3 1.9E3 76.27 268 282 N Deamidation (NQ)
K.HTAPIHAEAPEFTDMSVEQEILVTGIK.V Y 0.23 7.03 988.5039 123.76 - 129.32 3 1.5E3 125.65 165 191 N
F.QVAEVFTGHMGK.L Y 0.03 0.41 435.2230 60.76 - 64.19 3 1.4E3 62.46 472 483 N
K.HTAPIHAEAPEFTDMSVEQEILVTGIK.V Y 0.01 5.13 741.6328 125.01 - 127.16 4 1.2E3 125.72 165 191 N
R.FTQAGSEVSALLGR.I Y 0.06 2.21 479.2634 99.10 - 103.50 3 1.2E3 101.76 314 327 N
K.LVPLKETIK.G Y 0.03 3.07 347.5629 55.33 - 56.58 3 1.1E3 56.04 484 492 N
R.IMDPNIVGTEHYEIAR.G Y 0.01 5.08 929.4824 83.73 - 85.15 2 1.1E3 84.53 410 425 N
K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A Y 0.14 6.15 961.4966 129.25 - 130.44 4 910.8 129.68 354 390 N
R.I(+43.01)MNVIGEPIDER.G Y 0.08 1.32 714.8696 128.18 - 133.01 2 760.7 131.41 147 158 N Carbamylation
K.TVLIMELINNVAK.A Y 1.04 5.76 486.6219 133.79 - 136.10 3 751.5 135.66 216 228 N
R.IPSAVGYQPTLATDMGTMQER.I Y 0.03 5.29 756.0378 100.12 - 100.85 3 697.9 100.52 328 348 N
R.TREGNDLYHEMIESGVINLK.D Y 0.03 5.38 580.2964 115.86 - 117.17 4 690.5 116.52 243 262 N
R.EGNDLYHEMIESGVINLK.D Y 0.06 1.78 687.6727 124.74 - 127.14 3 591.8 125.46 245 262 N
K.VVDLLAPYAK(+28.03).G Y 0.42 7.76 558.8427 113.17 - 114.16 2 529 113.62 192 201 N Dimethylation (K)
K.SLQDIIAILGMDELSEEDKLTVAR.A Y 0.52 0.31 887.1377 135.56 - 137.02 3 303.4 136.62 436 459 N
K.VVDLLAPYAK.G Y 0.00 0.58 544.8160 98.23 - 99.61 2 227.4 98.89 192 201 N
K.TVLIMELINNVAK.A Y 0.06 4.25 729.4136 135.25 - 135.97 2 179.6 135.46 216 228 N
total 64 peptides