| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.AGFAGDDAPR.A 6.86 2.47 488.7322 36.35 - 47.02 2 3.7E6 39.82 21 30 N
K.EITALAPSTMK.I 5.67 1.62 581.3179 64.83 - 71.78 2 3.2E6 67.69 318 328 N
R.AVFPSIVGRPR.H 2.19 9.44 400.2416 75.91 - 81.36 3 3E6 77.77 31 41 N
R.VAPEEHPTLLTEAPLNPK.A 4.46 3.89 652.6904 83.00 - 88.22 3 2.5E6 84.99 98 115 N
K.DSYVGDEAQSK.R 5.27 1.57 599.7699 31.97 - 41.34 2 2.1E6 34.53 53 63 N
R.HQGVMVGMGQK.D 4.52 3.66 586.2934 38.60 - 49.34 2 2.1E6 42.07 42 52 N
R.AVFPSIVGRPR.H 4.59 6.51 599.8602 74.67 - 81.75 2 1.7E6 77.17 31 41 N
K.YPIE(+14.02)HGIITNWDDMEK.I 3.79 2.36 658.9835 102.80 - 107.55 3 1.7E6 104.73 71 86 N Methylation (DE)
R.HQGVMVGMGQK.D 4.82 1.80 391.1979 38.61 - 49.54 3 1.5E6 42.23 42 52 N
R.AVFPSIVGR.P 4.74 0.61 473.2823 85.98 - 90.91 2 1.5E6 88.38 31 39 N
K.IIAPPER.K 5.15 3.27 398.2423 39.05 - 49.34 2 1E6 42.75 331 337 N
K.RGILTLK.Y 5.08 4.03 400.7737 52.94 - 61.25 2 9.8E5 56.34 64 70 N
K.IWHHTFYNELR.V 3.15 12.95 505.9253 64.32 - 72.97 3 9.8E5 67.80 87 97 N
R.DLTDYLMK.I 4.36 10.50 499.7495 100.85 - 105.35 2 9.1E5 102.35 186 193 N
K.SYELPDGQVITIGNER.F 2.70 1.78 895.9551 104.04 - 109.77 2 8.9E5 106.16 241 256 N
R.GILTLK.Y 3.58 2.83 644.4395 66.54 - 74.10 1 8.8E5 69.56 65 70 N
V.FPSIVGRPR.H 3.60 8.41 514.8073 74.74 - 81.72 2 6.9E5 77.17 33 41 N
R.H(+43.01)QGVMVGMGQK.D 3.49 2.08 607.7964 48.44 - 58.56 2 5.5E5 51.84 42 52 N Carbamylation
K.SYELPDGQVITIGNER.F 2.20 2.35 597.6405 104.34 - 109.13 3 4.8E5 106.06 241 256 N
K.ILTER.G 2.88 6.87 316.1939 31.59 - 38.22 2 4E5 33.25 194 198 N
K.YPIEHGIITNWDDMEK.I 3.14 2.46 980.9638 95.22 - 100.96 2 3.9E5 97.45 71 86 N
R.GYSFVTTAER.E 3.35 8.70 565.7820 62.10 - 69.22 2 3.8E5 64.85 199 208 N
R.HQ(+.98)GVMVGMGQK.D 1.24 2.59 586.7965 38.61 - 48.64 2 3.4E5 42.35 42 52 N Deamidation (NQ)
R.A(+43.01)VFPSIVGRPR.H 2.95 6.02 621.3630 98.75 - 103.11 2 2.8E5 100.72 31 41 N Carbamylation
K.DSYVGDEAQSKR.G 2.40 13.82 677.8200 29.92 - 36.86 2 2.6E5 32.47 53 64 N
L.TEAPLNPK.A 3.02 3.02 435.2426 32.88 - 42.14 2 2.6E5 35.76 108 115 N
K.DLYANNVLSGGTTMYPGIADR.M 1.30 1.23 743.3638 112.07 - 116.15 3 2.5E5 113.53 294 314 N
R.KDLYANNVLSGGTTMYPGIADR.M 3.46 2.49 786.0628 96.65 - 101.47 3 2.4E5 98.46 293 314 N
K.YPIE(+14.02)HGIITNWDDMEK.I 2.64 3.08 987.9726 102.90 - 107.74 2 2.2E5 104.71 71 86 N Methylation (DE)
K.AGFAGDDAPR.A 4.09 7.06 976.4540 36.35 - 46.93 1 2.1E5 39.80 21 30 N
K.IWHHTFYNELR.V 1.59 2.33 379.6947 64.35 - 73.37 4 2.1E5 68.15 87 97 N
K.DSYVGDEAQSKR.G 1.64 6.64 452.2183 30.71 - 38.64 3 2E5 32.61 53 64 N
F.PSIVGRPR.H 2.41 4.65 441.2728 74.64 - 81.36 2 2E5 77.14 34 41 N
K.DSYVGDEAQSK.R 3.20 7.02 1198.5318 31.97 - 41.44 1 1.8E5 34.62 53 63 N
R.VAPEEHPTLLTEAPLNPK.A 2.90 3.46 978.5301 82.73 - 87.98 2 1.8E5 84.91 98 115 N
K.IKIIAPPER.K 3.49 0.99 346.2239 51.98 - 60.32 3 1.5E5 55.31 329 337 N
K.IIAPPERK.Y 3.40 1.60 308.5287 32.43 - 42.01 3 1.4E5 35.26 331 338 N
R.G(+43.01)ILTLK.Y 3.51 1.38 687.4441 95.05 - 99.61 1 1.4E5 96.99 65 70 N Carbamylation
R.LDLAGR.D 2.13 6.50 644.3795 40.29 - 50.31 1 1.4E5 43.99 180 185 N
Y.ANNVLSGGTTMYPGIADR.M 2.61 0.86 918.9549 86.97 - 90.71 2 1.4E5 88.48 297 314 N
K.IWHHTFYNELR.V 0.94 0.78 758.3840 64.12 - 72.50 2 1.3E5 68.04 87 97 N
K.DLYANNVLSGGTTMYPGIADR.M 2.44 3.96 1114.5412 112.10 - 115.80 2 1.2E5 113.42 294 314 N
K.Q(-17.03)EYDEAGPSIVHR.K 2.30 0.50 742.3504 60.32 - 67.30 2 1.1E5 63.56 362 374 N Pyro-glu from Q
K.EITALAPSTMK.I 3.30 1.56 1161.6242 64.83 - 71.85 1 1.1E5 67.69 318 328 N
K.QEYDEAGPSIVHR.K 2.67 12.11 500.9106 46.71 - 56.03 3 1E5 50.33 362 374 N
R.DLTDYLMK.I 2.44 12.90 998.4894 100.75 - 105.38 1 1E5 102.35 186 193 N
Y.ANNVLSGGTTMYPGIADR.M 1.80 2.12 612.9745 87.07 - 91.10 3 9.3E4 88.53 297 314 N
K.IKIIAPPER.K 3.44 0.83 518.8331 51.95 - 60.32 2 9.1E4 55.31 329 337 N
V.FPSIVGRPR.H 2.73 8.55 343.5398 74.67 - 81.39 3 9.1E4 77.23 33 41 N
Y.ALPHAIMR.L 2.23 2.56 303.5109 46.10 - 55.93 3 8.9E4 49.80 172 179 N
K.IIAPPERK.Y 3.17 2.75 462.2904 32.50 - 41.71 2 8.5E4 35.26 331 338 N
K.SYELPDGQVITIGNER.F 0.15 5.81 597.6271 104.18 - 107.41 3 8.5E4 105.95 241 256 N
F.YNELR.V 1.85 1.29 347.6812 30.96 - 37.51 2 8.5E4 32.85 93 97 N
R.HQGVMVGMGQK.D 3.16 6.14 1171.5766 38.64 - 49.01 1 8.4E4 42.05 42 52 N
K.IKIIAPPERK.Y 3.37 5.45 388.9226 42.50 - 52.28 3 8.1E4 46.39 329 338 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.45 1.21 668.6490 124.90 - 127.94 3 8.1E4 126.53 71 86 N Carbamylation
K.CDIDIR.K 1.52 2.90 367.6815 47.34 - 56.49 2 7.4E4 50.93 287 292 N
K.Q(-17.03)EYDEAGPSIVHRK.C 2.11 3.66 537.9343 49.44 - 58.46 3 7E4 53.08 362 375 N Pyro-glu from Q
K.I(+43.01)WHHTFYNELR.V 1.70 2.83 520.2610 105.64 - 111.13 3 6E4 107.63 87 97 N Carbamylation
K.A(+43.01)GFAGDDAPR.A 1.35 0.55 510.2372 49.09 - 55.35 2 5.7E4 52.40 21 30 N Carbamylation
F.QQMWISK.Q 1.13 7.43 460.7397 53.74 - 62.81 2 5.4E4 57.50 355 361 N
K.D(+43.01)SYVGDEAQSK.R 2.25 0.68 621.2725 39.12 - 49.90 2 4.8E4 43.02 53 63 N Carbamylation
K.YPIE(+14.02)HGIITNWDDMEK.I 0.01 5.14 658.9848 103.30 - 107.61 3 4.5E4 104.70 71 86 N Methylation (DE)
H.GIITNWDDMEK.I 2.06 0.09 661.3147 94.98 - 98.75 2 4.4E4 96.35 76 86 N
R.HQGVM(+15.99)VGMGQK.D 1.61 5.87 594.2885 32.36 - 41.64 2 4.3E4 35.43 42 52 N Oxidation (M)
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.14 0.21 1002.4672 124.78 - 128.22 2 4.2E4 126.58 71 86 N Carbamylation
K.QEYDEAGPSIVHRK.C 1.16 0.80 543.6101 38.67 - 46.12 3 4.1E4 42.73 362 375 N
K.C(+57.02)DIDIR.K 1.07 0.37 396.1956 42.45 - 51.78 2 4.1E4 45.99 287 292 N Carbamidomethylation
R.G(+43.01)ILTLK.Y 2.36 0.44 344.2257 95.05 - 99.17 2 3.8E4 97.00 65 70 N Carbamylation
K.EITALAP(+31.99)STMK.I 1.22 1.10 597.3123 77.48 - 82.06 2 3.5E4 79.51 318 328 N Dihydroxylation [P]
K.IIAPPER.K 2.79 4.20 795.4768 39.02 - 49.20 1 3.3E4 42.74 331 337 N
R.V(+43.01)APEEHPTLLTEAPLNPK.A 1.95 1.58 667.0250 101.30 - 104.58 3 3.2E4 102.77 98 115 N Carbamylation
K.CDIDIRK.D 0.77 3.12 431.7311 35.29 - 43.68 2 2.8E4 39.71 287 293 N
K.QEYDEAGPSIVHRK.C 0.94 1.36 407.9593 38.44 - 46.36 4 2.8E4 43.21 362 375 N
K.R(+43.01)GILTLK.Y 1.34 2.92 422.2747 72.00 - 77.89 2 2.7E4 74.52 64 70 N Carbamylation
R.MQKEITALAPSTMK.I 1.41 4.79 516.9457 64.08 - 68.49 3 2.7E4 66.78 315 328 N
K.D(+43.01)SYVGDEAQSKR.G 0.55 2.04 699.3286 35.27 - 44.74 2 2.7E4 38.84 53 64 N Carbamylation
K.IKIIAPPERK.Y 2.82 5.26 582.8806 42.47 - 52.35 2 2.6E4 46.39 329 338 N
Y.SFVTTAER.E 1.12 4.86 455.7374 40.95 - 50.87 2 2.5E4 45.26 201 208 N
K.C(+42.01)DIDIR.K 1.33 0.01 388.6927 52.62 - 61.18 2 2.4E4 56.14 287 292 N Acetylation (Protein N-term)
K.EITALAPSTMK.I 0.43 0.02 581.3080 67.45 - 75.08 2 2.3E4 70.63 318 328 N
K.DLYANNVLSGGTTMYPGIADR.M 0.10 2.91 743.3623 112.95 - 118.48 3 2.3E4 116.35 294 314 N
K.C(+43.01)DIDIR.K 1.04 1.56 389.1857 45.00 - 54.30 2 2.3E4 48.54 287 292 N Carbamylation
L.TEAPLNPK.A 2.10 0.52 869.4782 32.57 - 41.88 1 2.2E4 35.64 108 115 N
R.KDLYANNVLSGGTTMYPGIADR.M 2.03 2.67 1178.5902 96.76 - 100.53 2 2.1E4 98.43 293 314 N
K.E(-18.01)ITALAPSTMK.I 0.95 3.93 572.3133 92.60 - 97.67 2 2.1E4 94.84 318 328 N Pyro-glu from E
R.LDLAGRDLTDYLMK.I 2.05 0.37 541.9556 117.51 - 120.61 3 2E4 118.86 180 193 N
L.SGGTTMYPGIADR.M 0.76 0.77 663.3188 58.35 - 63.19 2 1.8E4 60.92 302 314 N
K.YPIE(+14.02)HGIITNWDDMEK.I 0.02 5.48 987.9653 103.29 - 106.61 2 1.8E4 104.89 71 86 N Methylation (DE)
K.IWHHTFYNELR.V 0.13 3.06 758.3723 66.80 - 72.74 2 1.8E4 69.46 87 97 N
R.HQGVM(+15.99)VGMGQK.D 0.50 3.48 396.5294 33.29 - 42.04 3 1.8E4 35.40 42 52 N Oxidation (M)
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.27 1.14 866.1704 129.58 - 131.38 4 1.7E4 130.04 257 286 N Carbamidomethylation
K.E(+43.01)ITALAPSTMK.I 2.11 1.07 1204.6323 95.75 - 99.28 1 1.6E4 97.46 318 328 N Carbamylation
V.T(+42.01)TAER.E 0.84 0.00 619.2815 36.85 - 41.75 1 1.6E4 39.49 204 208 N Acetylation (Protein N-term)
S.KQEYDEAGPSIVHR.K 0.41 2.31 543.6093 42.05 - 48.02 3 1.6E4 45.31 361 374 N
R.A(+43.01)VFPSIVGRPR.H 2.07 3.81 414.5781 98.67 - 102.81 3 1.5E4 100.72 31 41 N Carbamylation
K.C(+57.02)DIDIR.K 0.19 6.29 396.1893 44.62 - 47.80 2 1.5E4 45.94 287 292 N Carbamidomethylation
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.88 1.56 1038.4936 132.39 - 134.77 3 1.5E4 133.20 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.QEYDEAGPSIVHRK.C 1.28 0.13 814.9105 38.57 - 46.15 2 1.4E4 42.66 362 375 N
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.43 0.35 1053.4975 129.37 - 132.98 3 1.4E4 131.03 259 286 N Carbamidomethylation
K.SYE(+21.98)LPDGQVITIGNER.F 0.87 0.56 906.9437 104.73 - 108.35 2 1.4E4 106.19 241 256 N Sodium adduct
R.GILTLKYPIEHGIITNWDDMEK.I 0.75 3.36 647.3404 125.21 - 128.50 4 1.4E4 126.73 65 86 N
K.S(+43.01)YELPDGQVITIGNER.F 0.99 1.63 917.4540 118.78 - 123.41 2 1.4E4 121.26 241 256 N Carbamylation
K.A(+42.01)GFAGDDAPR.A 0.11 5.88 509.7334 50.77 - 53.70 2 1.3E4 52.23 21 30 N Acetylation (Protein N-term)
K.YPIEHGIITNWDDMEK.I 0.70 0.23 654.2881 97.78 - 103.47 3 1.1E4 99.77 71 86 N
K.CD(+21.98)IDIR.K 1.31 3.44 378.6722 71.73 - 75.58 2 1E4 73.88 287 292 N Sodium adduct
K.I(+43.01)WHHTFYNELR.V 0.57 1.26 779.8864 105.88 - 111.05 2 9.9E3 107.56 87 97 N Carbamylation
K.EITALAPSTMK.I 0.06 2.11 581.3153 67.73 - 71.49 2 9.7E3 69.05 318 328 N
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 1.00 0.45 779.1181 132.08 - 133.69 4 8.8E3 132.65 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
R.A(+43.01)VFPSIVGRPR.H 0.05 3.37 621.3626 98.64 - 101.92 2 8.5E3 100.30 31 41 N Carbamylation
R.MQKEITALAPSTMK.I 0.96 4.15 774.9140 64.04 - 68.83 2 8.4E3 66.67 315 328 N
C.D(+42.01)DDETTALVCDNGSGLVK.A Y 0.81 2.15 947.4298 95.41 - 99.26 2 7.9E3 97.63 3 20 Y Acetylation (Protein N-term)
L.ASLSTFQQMWISK.Q 0.54 8.13 763.8854 120.92 - 123.50 2 7.6E3 121.81 349 361 N
R.HQGVMVGMGQK.D 0.14 0.06 391.2063 42.29 - 45.80 3 7.5E3 44.25 42 52 N
R.AVFPSIVGRPR.H 0.03 5.26 400.2442 78.90 - 83.75 3 7.4E3 80.46 31 41 N
Y.VALDFENEMATAASSSSLEK.S 0.76 0.43 1050.4997 112.30 - 115.95 2 7.2E3 113.49 221 240 N
R.M(+43.01)QKEITALAPSTMK.I 0.80 1.47 796.4156 84.19 - 86.66 2 7.2E3 85.36 315 328 N Carbamylation
R.GILTLKYPIE(+14.02)HGIITNWDDMEK.I 0.98 3.98 650.8458 128.42 - 129.43 4 7.2E3 128.86 65 86 N Methylation (DE)
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.95 0.26 1048.8271 127.47 - 132.02 3 7E3 131.13 259 286 N Carbamylation
R.D(+43.01)LTDYLMK.I 1.16 9.05 521.2535 117.27 - 119.05 2 7E3 118.11 186 193 N Carbamylation
R.V(+43.01)APEEHPTLLTEAPLNPK.A 0.55 1.55 1000.0326 101.50 - 104.49 2 6.9E3 102.85 98 115 N Carbamylation
R.F(+43.01)RCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.44 0.78 862.6653 129.90 - 131.59 4 6.8E3 130.32 257 286 N Carbamylation
K.DSYVGDEAQSK.R 0.02 3.87 599.7742 33.05 - 44.33 2 6.8E3 35.41 53 63 N
R.G(+43.01)YSFVTTAER.E 0.30 0.14 587.2946 84.31 - 88.66 2 6.2E3 86.20 199 208 N Carbamylation
R.GILTLKYPIEHGIITNWDDMEK.I 1.07 5.24 862.7833 125.34 - 127.43 3 5.5E3 126.55 65 86 N
R.HQGVMVGMGQK.D 1.47 1.39 391.1940 106.34 - 110.45 3 5.5E3 108.20 42 52 N
K.I(+43.01)IAPPER.K 0.14 5.99 419.7466 71.57 - 74.74 2 5.3E3 73.51 331 337 N Carbamylation
Y.ANNVLSGGTTMYPGIADR.M 0.68 0.26 918.9252 85.10 - 90.28 2 5E3 87.48 297 314 N
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.33 0.13 1053.4985 130.80 - 134.51 3 4.8E3 131.65 259 286 N Carbamidomethylation
R.LDLAGRDLTDYLMK.I 0.56 0.12 812.4276 117.64 - 119.71 2 4.8E3 118.77 180 193 N
K.YPIE(+14.02)HGIITNWDDMEK.I 0.24 3.20 658.9872 95.97 - 98.66 3 4.4E3 97.27 71 86 N Methylation (DE)
R.D(+43.01)LTDYLMK.I 0.84 4.07 1041.4966 116.87 - 119.71 1 4.2E3 118.12 186 193 N Carbamylation
K.LC(+57.02)YVALDFENEMATAASSSSLEK.S 0.40 0.34 846.0626 128.85 - 132.28 3 4.1E3 131.05 218 240 N Carbamidomethylation
K.IK(+43.01)IIAPPER.K 1.10 1.31 360.5600 52.94 - 60.32 3 4E3 55.24 329 337 N Carbamylation
R.MQK(+43.01)EITALAPSTMK.I 0.08 4.07 531.2757 83.22 - 86.20 3 3.8E3 84.75 315 328 N Carbamylation
L.STFQQMWISK.Q 0.05 5.54 628.3135 94.45 - 97.31 2 3.8E3 95.84 352 361 N
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 0.19 1.43 1034.4926 130.99 - 134.59 3 3.5E3 132.16 259 286 N
R.AVFPSIVGRPR.H 0.19 0.49 599.8507 73.72 - 78.22 2 3.4E3 75.20 31 41 N
R.K(+43.01)DLYANNVLSGGTTMYPGIADR.M 0.41 1.37 800.3953 109.42 - 111.58 3 3.3E3 110.72 293 314 N Carbamylation
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.07 2.61 866.1727 129.67 - 131.10 4 3.3E3 130.22 257 286 N Carbamidomethylation
K.D(+42.01)LYANNVLSGGTTMYPGIADR.M 0.26 1.95 568.2618 115.47 - 117.74 4 3.3E3 116.55 294 314 N Acetylation (Protein N-term)
K.D(+43.01)LYANNVLSGGTTMYPGIADR.M 0.17 0.82 757.7011 125.93 - 127.80 3 3.3E3 126.53 294 314 N Carbamylation
K.QEYDEAGPSIVHRK.C 0.22 1.52 814.9119 40.29 - 47.99 2 3.1E3 45.15 362 375 N
R.HQGVMVGMGQK(+43.01)DSYVGDEAQSK.R 0.13 0.82 798.7041 67.69 - 70.02 3 2.8E3 68.60 42 63 N Carbamylation
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.23 0.51 790.3789 130.81 - 131.89 4 2.8E3 131.14 259 286 N Carbamidomethylation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.64 1.25 1135.5475 130.75 - 133.44 3 2.7E3 131.31 257 286 N
K.DLYANNVLS(-18.01)GGTTMYPGIADR.M 0.04 5.60 737.3672 115.20 - 117.88 3 2.6E3 116.41 294 314 N Phospho neutral loss (ST)
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.04 0.65 779.1250 132.52 - 133.76 4 2.4E3 133.10 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.C(+43.01)(+45.99)DIDIR.K 0.44 7.99 412.1790 48.64 - 52.55 2 2.4E3 50.91 287 292 N Carbamylation; Beta-methylthiolation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.10 0.10 851.9174 130.76 - 131.91 4 2.3E3 131.30 257 286 N
R.G(+43.01)ILTLK.Y 0.52 0.12 344.2255 92.57 - 99.17 2 2.1E3 94.70 65 70 N Carbamylation
K.SYELPDGQVITIGNER.F 0.12 0.27 895.9541 96.81 - 99.17 2 2E3 97.61 241 256 N
K.SYELPDGQVITIGNER.F 0.02 0.77 597.6383 95.83 - 99.51 3 2E3 97.80 241 256 N
K.S(+43.01)YELPDGQVITIGNER.F 0.06 0.47 917.4686 119.06 - 122.81 2 1.8E3 121.35 241 256 N Carbamylation
K.IWHHTFYNELR.V 0.05 0.14 379.6929 68.64 - 78.73 4 1.6E3 71.33 87 97 N
R.M(+43.01)QKEITALAPSTMK.I 0.01 2.61 531.2851 84.14 - 86.72 3 1.5E3 85.66 315 328 N Carbamylation
K.I(+43.01)LTER.G 0.16 3.77 337.6988 71.13 - 74.54 2 1.4E3 72.73 194 198 N Carbamylation
R.HQGVMVGM(+15.99)GQK.D 0.01 0.15 594.2908 26.85 - 32.44 2 1.3E3 30.58 42 52 N Oxidation (M)
K.D(+21.98)LYANNVLSGGTTM(+15.99)YPGIADR.M 0.09 5.44 567.2584 112.72 - 114.21 4 1.2E3 113.42 294 314 N Sodium adduct; Oxidation (M)
K.LCYVALDFENEMATAASSSSLEK.S 0.09 2.09 827.0503 132.42 - 136.12 3 1.1E3 135.05 218 240 N
K.EITALAPSTMK(+43.01)IK.I 0.52 2.06 482.6088 90.48 - 91.56 3 1E3 90.98 318 330 N Carbamylation
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.00 4.04 1048.8122 131.05 - 134.82 3 464.9 132.20 259 286 N Carbamylation
R.MQK(+43.01)EITALAPSTMK.I 0.01 0.63 796.4299 82.19 - 87.28 2 428.9 84.98 315 328 N Carbamylation
K.DLYANNVLSGGTTMYPGIADR.M 0.04 1.60 1114.5408 110.32 - 115.72 2 310.3 111.85 294 314 N
total 164 peptides