| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
Y.MVGPIEEVVLK.A Y 3.67 0.06 607.3500 103.73 - 108.02 2 3.2E5 105.63 512 522 Y
R.TIAMDGTEGLVR.G Y 3.32 1.90 631.8291 73.80 - 78.88 2 2.3E5 75.67 113 124 Y
R.IPVGPETLGR.I Y 2.99 0.50 519.8057 63.30 - 70.63 2 2.1E5 66.13 137 146 Y
R.IMDPNIVGTEHYEIAR.G Y 1.97 1.73 619.9817 82.63 - 87.59 3 2.1E5 84.63 410 425 N
R.IMNVIGEPIDER.G Y 2.59 1.77 693.3639 85.10 - 89.57 2 1.8E5 87.07 147 158 N
K.ILQDYK.S Y 2.18 0.26 390.2207 36.33 - 46.13 2 1.2E5 39.54 430 435 N
K.VLDTGAPIRIPVGPETLGR.I Y 2.52 5.45 654.3814 106.81 - 110.94 3 1.2E5 108.95 128 146 N
K.VVDLLAPYAK.G Y 2.61 2.08 544.8238 97.07 - 101.12 2 1.1E5 98.79 192 201 N
R.FLSQPFQVAEVFTGHMGK.L Y 2.71 13.05 675.0117 130.84 - 132.55 3 8.7E4 131.48 466 483 N
K.IGLFGGAGVGK.T Y 2.03 2.19 488.2879 85.56 - 90.81 2 8.4E4 87.71 205 215 N
R.FTQAGSEVSALLGR.I Y 1.75 0.95 718.3841 99.13 - 103.62 2 8.3E4 101.64 314 327 N
K.VALVYGQMNEPPGAR.A Y 2.00 0.88 801.4123 74.11 - 79.49 2 8.2E4 76.38 268 282 N
R.LVLEVAQHLGENTVR.T Y 2.35 0.00 559.9837 90.63 - 95.73 3 6.7E4 92.33 98 112 N
Y.VAPAAAVTVAAGR.I Y 1.97 2.36 577.3417 51.36 - 59.62 2 6.4E4 54.73 53 65 N
R.IPSAVGYQPTLATDMGTMQER.I Y 1.52 0.76 756.0368 99.25 - 102.24 3 5.8E4 100.45 328 348 N
R.IMNVIGEPIDERGPISTK.H Y 1.90 3.34 657.0235 89.49 - 93.23 3 5.2E4 91.01 147 164 N
R.IMDPNIVGTEHY.E Y 2.15 10.55 694.8326 80.09 - 84.58 2 4.5E4 81.90 410 421 N
R.AIAELGIYPAVDPLDSTSR.I Y 2.62 0.24 663.3529 123.97 - 127.01 3 4.4E4 125.43 391 409 N
R.VALTGLSVAEYFR.D Y 1.70 0.15 713.3942 128.61 - 129.90 2 3.5E4 129.20 285 297 N
K.ILQDYK.S Y 2.53 0.85 779.4346 36.58 - 46.10 1 3.1E4 39.64 430 435 N
R.AIAELGIYPAVDPLDSTSR.I Y 2.22 0.61 994.5249 123.98 - 127.03 2 2.8E4 125.43 391 409 N
K.I(+43.01)GLFGGAGVGK(+43.01).T Y 0.31 0.41 531.2914 40.27 - 47.08 2 2.5E4 43.88 205 215 N Carbamylation
R.IPVGPETLGR.I Y 0.06 5.43 519.7955 65.44 - 67.31 2 2.3E4 66.41 137 146 N
K.LVPLKETIK.G Y 1.51 4.29 347.5637 51.81 - 56.98 3 2.1E4 55.15 484 492 N
R.LVLEVAQHLGENTVR.T Y 2.31 0.78 839.4739 90.60 - 94.31 2 2E4 92.33 98 112 N
F.AHLDATTVLSR.A Y 0.64 1.34 395.2197 58.30 - 65.11 3 1.9E4 60.84 380 390 N
R.IPSAVGYQPTLATDMGTMQER.I Y 2.01 0.92 1133.5519 99.10 - 102.75 2 1.7E4 100.55 328 348 N
R.FTQAGSEVSALLGR.I Y 1.34 0.34 479.2609 99.08 - 103.65 3 1.6E4 101.63 314 327 N
R.EGNDLYHEMIESGVINLK.D Y 1.32 3.37 687.6729 124.26 - 127.23 3 1.5E4 125.67 245 262 N
K.LVPLKETIK.G Y 1.39 4.25 520.8444 51.78 - 56.94 2 1.5E4 55.09 484 492 N
R.IPSAVGYQPTLATDMGTMQER.I Y 0.20 1.25 756.0194 98.45 - 102.09 3 1.1E4 99.97 328 348 N
R.EGNDLYHEMIESGVINLKDDTSK.V Y 0.81 1.40 652.5654 117.77 - 119.80 4 8.7E3 118.78 245 267 N
K.TVLIMELINNVAK.A Y 1.52 0.67 729.4288 133.71 - 136.18 2 8E3 135.73 216 228 N
K.HTAPIHAEAPEFTDMSVEQEILVTGIK.V Y 0.09 5.47 741.6301 124.66 - 127.35 4 7.9E3 125.82 165 191 N
R.TREGNDLYHEMIESGVINLKDDTSK.V Y 0.29 2.28 716.8533 109.05 - 112.12 4 7.5E3 110.63 243 267 N
R.T(+43.01)IAMDGTEGLVR.G Y 0.29 0.78 653.3309 93.95 - 96.91 2 7.5E3 95.31 113 124 N Carbamylation
K.ILQDYK.S Y 0.04 5.47 390.2218 41.00 - 47.16 2 7.2E3 43.29 430 435 N
R.FTQAGSEVSALLGR.I Y 0.12 0.37 718.3815 98.95 - 103.62 2 7E3 101.01 314 327 N
R.VALTGLSVAEYFR.D Y 0.06 5.65 713.3878 128.97 - 129.45 2 6E3 129.11 285 297 N
Y.VAPAAAVTVAAGR.I Y 0.18 6.45 385.2310 51.93 - 57.33 3 4.9E3 55.04 53 65 N
R.IMNVIGEPIDER.G Y 0.51 3.17 462.5764 85.14 - 89.47 3 4.6E3 86.95 147 158 N
R.VALTGLSVAEYFR.D Y 1.11 0.19 475.9327 128.29 - 129.63 3 4.2E3 129.12 285 297 N
Y.M(+43.01)VGPIEEVVLK.A Y 0.81 0.14 628.8546 132.43 - 133.77 2 4.1E3 133.13 512 522 N Carbamylation
K.IGLFGGAGVGK.T Y 0.05 0.18 488.2804 85.82 - 89.78 2 4E3 88.12 205 215 N
R.AIAELGIYPAVD(+21.98)PLDSTSR.I Y 0.60 0.18 670.6788 124.42 - 126.64 3 3.9E3 125.48 391 409 N Sodium adduct
R.EGNDLYHEMIESGVINLKDDTSK.V Y 0.68 0.59 869.7518 117.74 - 120.75 3 3.9E3 118.93 245 267 N
K.VVDLLAPYAK.G Y 1.79 1.45 1088.6414 97.07 - 99.86 1 3.4E3 98.64 192 201 N
R.FLSQPFQVAEVFTGHMGK.L Y 0.78 1.74 1012.0185 130.81 - 131.92 2 3E3 131.40 466 483 N
R.IMNVIGEPIDER.G Y 0.02 1.70 693.3665 85.90 - 87.55 2 2.7E3 86.90 147 158 N
R.IMNVIGEPIDERGPISTK.H Y 0.79 0.76 985.0314 89.62 - 92.00 2 2.7E3 90.71 147 164 N
K.VALVYGQMN(+.98)EPPGAR.A Y 0.05 0.82 534.9482 75.40 - 77.70 3 2.6E3 76.27 268 282 N Deamidation (NQ)
K.HTAPIHAEAPEFTDMSVEQEILVTGIK.V Y 0.23 0.28 988.5048 123.76 - 126.62 3 2E3 125.37 165 191 N
F.QVAEVFTGHMGK.L Y 0.03 5.41 435.2230 60.76 - 64.19 3 1.9E3 62.46 472 483 N
K.HTAPIHAEAPEFTDMSVEQEILVTGIK.V Y 0.01 5.11 741.6328 125.01 - 127.16 4 1.6E3 125.72 165 191 N
R.FTQAGSEVSALLGR.I Y 0.06 1.05 479.2634 99.10 - 103.50 3 1.6E3 101.76 314 327 N
K.LVPLKETIK.G Y 0.04 5.27 347.5629 55.33 - 56.58 3 1.5E3 56.04 484 492 N
R.IMDPNIVGTEHYEIAR.G Y 0.01 1.31 929.4824 83.73 - 85.15 2 1.5E3 84.53 410 425 N
K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A Y 0.15 0.30 961.4966 129.25 - 130.44 4 1.2E3 129.68 354 390 N
R.I(+43.01)MNVIGEPIDER.G Y 0.16 1.37 714.8774 131.41 - 134.59 2 1.2E3 132.34 147 158 N Carbamylation
K.TVLIMELINNVAK.A Y 1.05 2.43 486.6219 133.79 - 136.10 3 1E3 135.66 216 228 N
R.IPSAVGYQPTLATDMGTMQER.I Y 0.03 2.34 756.0378 100.12 - 100.85 3 950.6 100.52 328 348 N
R.TREGNDLYHEMIESGVINLK.D Y 0.03 5.59 580.2964 115.86 - 117.17 4 940.5 116.52 243 262 N
R.EGNDLYHEMIESGVINLK.D Y 0.06 1.86 687.6727 124.74 - 127.14 3 806.1 125.46 245 262 N
K.VVDLLAPYAK(+28.03).G Y 0.49 7.60 558.8427 113.17 - 114.16 2 720.6 113.62 192 201 N Dimethylation (K)
K.SLQDIIAILGMDELSEEDKLTVAR.A Y 0.61 1.35 887.1380 135.53 - 137.02 3 506.2 136.59 436 459 N
K.VVDLLAPYAK.G Y 0.00 5.15 544.8160 98.23 - 99.61 2 309.8 98.89 192 201 N
K.TVLIMELINNVAK.A Y 0.07 2.32 729.4136 135.25 - 135.97 2 244.7 135.46 216 228 N
total 67 peptides