| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.GASQAGMTAPGTR.R 2.10 0.57 602.7980 32.01 - 36.60 2 1.1E5 34.23 213 225 N
R.VDIGVK.Y Y 1.83 0.41 315.6980 39.95 - 44.83 2 7.8E4 42.69 138 143 Y
R.MFDEEK.M Y 2.27 0.60 399.6746 35.98 - 40.33 2 7E4 38.03 151 156 Y
R.AIYDQK.L Y 1.78 0.49 369.1985 31.56 - 35.67 2 4.8E4 33.80 227 232 Y
K.GPSFGLSAEIK.N Y 1.14 0.01 553.3007 83.71 - 87.60 2 4.5E4 85.60 7 17 N
K.AGQCVIGLQMGTNK.C Y 1.89 1.60 710.3639 79.92 - 84.53 2 4.1E4 81.83 159 172 N
K.AGQC(+57.02)VIGLQMGTNK.C Y 1.96 0.29 738.8752 73.72 - 76.73 2 2.9E4 75.45 159 172 N Carbamidomethylation
R.HLYDPK.V 0.32 0.24 386.7067 31.31 - 32.79 2 1.7E4 32.10 187 192 N
K.YDSQKEDELR.V Y 1.27 1.15 641.8059 30.92 - 34.44 2 1.7E4 32.47 24 33 N
K.INQSALNWHQLENLTNFIK.A Y 2.19 0.47 761.7390 131.66 - 132.40 3 1.6E4 132.02 73 91 N
K.VQIQPPMDNTTISLQMGTNK.G Y 0.64 0.28 739.3739 102.24 - 104.93 3 1.5E4 103.43 193 212 N
K.AGEVAEDQNGAGVVPDYIPDFQDEGYQGYQEEEQVYR.E Y 1.36 0.62 1041.9654 124.01 - 126.22 4 1.3E4 124.94 275 311 N
R.RHLYDPK.V 1.16 0.89 310.1752 29.60 - 31.54 3 9.5E3 30.62 186 192 N
R.VWIEELTGASIGSDFQK.G Y 1.36 1.00 627.3249 128.18 - 129.32 3 7.9E3 128.67 34 50 N
K.A(+43.01)GQCVIGLQMGTNK.C Y 0.32 0.84 731.8697 76.26 - 81.35 2 7.2E3 77.53 159 172 N Carbamylation
K.SGVILCTLINHLAPGSVK.K Y 1.18 1.83 608.0196 131.33 - 132.47 3 6.9E3 131.71 54 71 N
K.SGVILC(+57.02)TLINHLAPGSVK.K Y 1.60 2.66 627.0260 130.29 - 130.90 3 5.6E3 130.57 54 71 N Carbamidomethylation
R.QIYDAK.Y Y 0.51 0.27 737.3917 31.35 - 36.74 1 5.4E3 33.39 265 270 N
R.RAIYDQK.L Y 0.36 0.56 447.2497 30.29 - 32.36 2 5.3E3 31.26 226 232 N
C.TLINHLAPGSVK.K Y 0.07 1.47 417.2499 61.77 - 64.23 3 1.6E3 63.27 60 71 N
K.AGEVAEDQNGAGVVPDYIPDFQDEGYQGYQEEEQVYR.E Y 0.02 2.46 1041.9714 124.04 - 127.95 4 1E3 125.88 275 311 N
total 21 peptides