| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.AGFAGDDAPR.A 7.45 0.46 488.7336 36.35 - 42.07 2 4.6E6 39.08 21 30 N
K.EITALAPSTMK.I 5.89 1.76 581.3199 64.83 - 69.31 2 3.4E6 67.10 318 328 N
R.VAPEEHPTLLTEAPLNPK.A 4.89 1.29 652.6925 83.00 - 86.36 3 2.9E6 84.53 98 115 N
R.HQGVMVGMGQK.D 5.01 0.42 586.2958 38.61 - 47.15 2 2.6E6 41.30 42 52 N
K.DSYVGDEAQSK.R 5.62 1.54 599.7718 31.97 - 37.43 2 2.3E6 33.88 53 63 N
K.YPIE(+14.02)HGIITNWDDMEK.I 4.65 0.64 658.9861 102.80 - 106.35 3 2.3E6 104.24 71 86 N Methylation (DE)
R.AVFPSIVGRPR.H 6.03 1.07 599.8620 74.67 - 79.41 2 2.2E6 76.51 31 41 N
R.AVFPSIVGRPR.H 0.87 2.84 400.2435 76.08 - 79.48 3 2.1E6 76.88 31 41 N
R.HQGVMVGMGQK.D 4.87 0.03 391.1992 38.61 - 45.52 3 1.9E6 41.57 42 52 N
R.AVFPSIVGR.P 5.13 0.26 473.2844 85.98 - 89.49 2 1.6E6 87.82 31 39 N
K.IWHHTFYNELR.V 4.37 12.93 505.9270 64.32 - 72.67 3 1.4E6 66.92 87 97 N
K.RGILTLK.Y 5.68 2.47 400.7753 52.94 - 57.53 2 1.2E6 55.63 64 70 N
R.GILTLK.Y 3.70 0.25 644.4418 66.54 - 71.48 1 1E6 68.89 65 70 N
K.SYELPDGQVITIGNER.F 4.45 0.97 895.9582 104.34 - 107.58 2 1E6 105.77 241 256 N
K.IIAPPER.K 5.16 0.80 398.2434 39.22 - 44.58 2 8.3E5 42.08 331 337 N
R.DLTDYLMK.I 4.43 10.67 499.7517 100.85 - 104.38 2 6.8E5 102.14 186 193 N
K.SYELPDGQVITIGNER.F 4.95 0.10 597.6396 104.34 - 107.54 3 6.4E5 105.78 241 256 N
R.H(+43.01)QGVMVGMGQK.D 3.85 1.99 607.7981 48.44 - 54.43 2 6.2E5 51.15 42 52 N Carbamylation
R.HQ(+.98)GVMVGMGQK.D 1.89 5.57 586.7959 38.61 - 45.24 2 5.3E5 41.84 42 52 N Deamidation (NQ)
R.LDLAGR.D 3.18 17.04 322.6947 40.71 - 45.77 2 4.6E5 43.29 180 185 N
K.DSYVGDEAQSKR.G 3.34 4.07 677.8227 29.92 - 34.83 2 4.2E5 31.94 53 64 N
K.YPIEHGIITNWDDMEK.I 2.78 2.18 980.9674 95.22 - 99.33 2 4.2E5 97.11 71 86 N
K.DSYVGDEAQSKR.G 3.75 1.39 452.2186 30.71 - 34.51 3 3.6E5 31.94 53 64 N
K.DLYANNVLSGGTTMYPGIADR.M 1.69 1.61 743.3666 112.07 - 115.84 3 3.5E5 113.20 294 314 N
R.A(+43.01)VFPSIVGRPR.H 3.28 7.53 621.3650 98.75 - 101.64 2 3.3E5 100.32 31 41 N Carbamylation
R.GYSFVTTAER.E 3.41 16.81 565.7838 62.10 - 66.95 2 3.3E5 64.35 199 208 N
K.ILTER.G 3.01 10.74 316.1948 31.59 - 33.91 2 3.1E5 32.74 194 198 N
R.AVFPSIVGRPR.H 0.12 5.85 400.2449 76.53 - 83.75 3 3E5 80.00 31 41 N
K.AGFAGDDAPR.A 4.51 4.76 976.4570 36.35 - 42.17 1 2.7E5 39.06 21 30 N
L.TEAPLNPK.A 3.00 7.29 435.2441 32.88 - 37.98 2 2.6E5 35.14 108 115 N
K.YPIE(+14.02)HGIITNWDDMEK.I 3.07 5.66 987.9739 102.90 - 106.14 2 2.6E5 104.33 71 86 N Methylation (DE)
F.PSIVGRPR.H 3.11 1.59 441.2746 74.64 - 79.58 2 2.6E5 76.52 34 41 N
R.KDLYANNVLSGGTTMYPGIADR.M 2.96 3.50 786.0659 96.65 - 99.69 3 2.6E5 98.11 293 314 N
K.IWHHTFYNELR.V 1.56 1.85 379.6959 64.35 - 72.41 4 2.4E5 67.26 87 97 N
K.DSYVGDEAQSK.R 4.38 2.19 1198.5324 31.97 - 37.30 1 2.3E5 33.87 53 63 N
R.VAPEEHPTLLTEAPLNPK.A 3.32 3.78 978.5328 82.73 - 86.32 2 2.1E5 84.41 98 115 N
K.IWHHTFYNELR.V 1.34 2.48 758.3855 64.12 - 72.36 2 1.6E5 67.28 87 97 N
K.IIAPPERK.Y 3.76 2.15 308.5298 32.43 - 36.64 3 1.5E5 34.60 331 338 N
K.IKIIAPPER.K 3.65 1.23 346.2251 51.98 - 56.66 3 1.5E5 54.65 329 337 N
R.G(+43.01)ILTLK.Y 3.59 2.49 687.4458 95.05 - 98.27 1 1.4E5 96.65 65 70 N Carbamylation
Y.ANNVLSGGTTMYPGIADR.M 2.73 1.99 918.9568 86.97 - 89.44 2 1.4E5 88.20 297 314 N
K.DLYANNVLSGGTTMYPGIADR.M 2.52 1.77 1114.5439 112.10 - 115.23 2 1.4E5 113.16 294 314 N
K.ILTER.G 2.66 10.67 631.3840 31.23 - 33.91 1 1.3E5 32.74 194 198 N
V.FPSIVGRPR.H 3.25 1.87 343.5409 74.67 - 79.12 3 1.2E5 76.62 33 41 N
K.YPIE(+14.02)HGIIT(-18.01)NWDDMEK.I 2.00 2.56 652.9835 105.27 - 108.42 3 1.2E5 107.03 71 86 N Methylation (DE); Phospho neutral loss (ST)
R.LDLAGR.D 2.27 5.05 644.3800 40.32 - 45.51 1 1.1E5 43.29 180 185 N
R.HQGVMVGMGQK.D 3.78 4.59 1171.5798 38.64 - 46.61 1 1.1E5 41.30 42 52 N
K.Q(-17.03)EYDEAGPSIVHR.K 2.70 0.85 742.3525 60.32 - 64.87 2 1.1E5 63.01 362 374 N Pyro-glu from Q
K.IKIIAPPERK.Y 3.65 1.99 388.9240 42.63 - 47.70 3 1E5 45.72 329 338 N
K.CDIDIR.K 1.97 3.43 367.6825 47.53 - 53.83 2 9.9E4 50.26 287 292 N
K.EITALAPSTMK.I 3.50 10.11 1161.6276 64.83 - 69.28 1 9.9E4 67.09 318 328 N
K.IIAPPERK.Y 3.45 3.77 462.2918 32.50 - 36.60 2 9.6E4 34.60 331 338 N
K.Q(-17.03)EYDEAGPSIVHRK.C 2.43 1.81 537.9364 49.44 - 54.71 3 9.4E4 52.46 362 375 N Pyro-glu from Q
K.IKIIAPPER.K 3.57 1.49 518.8348 51.95 - 56.66 2 9.3E4 54.65 329 337 N
Y.ANNVLSGGTTMYPGIADR.M 1.67 2.50 612.9760 87.07 - 89.28 3 8.5E4 88.13 297 314 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.62 1.26 668.6509 124.90 - 127.37 3 8.1E4 126.28 71 86 N Carbamylation
F.YNELR.V 1.85 1.52 347.6822 30.96 - 33.62 2 7.8E4 32.31 93 97 N
Y.ALPHAIMR.L 2.23 1.98 303.5119 46.10 - 51.97 3 7.6E4 49.05 172 179 N
K.I(+43.01)WHHTFYNELR.V 2.23 3.38 520.2628 105.64 - 108.71 3 7.6E4 107.14 87 97 N Carbamylation
R.DLTDYLMK.I 2.51 6.49 998.4934 100.75 - 104.34 1 7.4E4 102.14 186 193 N
K.QEYDEAGPSIVHR.K 2.62 3.56 500.9124 46.71 - 53.11 3 6.6E4 49.69 362 374 N
R.HQGVM(+15.99)VGMGQK.D 1.79 2.63 594.2921 32.36 - 37.16 2 6.4E4 34.77 42 52 N Oxidation (M)
K.A(+43.01)GFAGDDAPR.A 1.68 1.65 510.2371 49.09 - 54.01 2 5.9E4 51.92 21 30 N Carbamylation
K.C(+57.02)DIDIR.K 1.79 1.42 396.1978 42.45 - 47.19 2 5.8E4 45.10 287 292 N Carbamidomethylation
R.HQGVMVGMGQK.D 0.02 1.06 586.2979 42.63 - 50.29 2 5.6E4 45.78 42 52 N
K.D(+43.01)SYVGDEAQSK.R 2.37 0.95 621.2743 39.22 - 45.07 2 5.1E4 42.35 53 63 N Carbamylation
H.GIITNWDDMEK.I 2.14 0.00 661.3162 94.98 - 97.19 2 4.6E4 96.05 76 86 N
K.CDIDIRK.D 1.28 2.63 431.7308 36.95 - 42.97 2 4.5E4 39.27 287 293 N
R.MQKEITALAPSTMK.I 2.12 5.86 516.9478 64.08 - 68.25 3 4.4E4 66.30 315 328 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.13 1.96 1002.4696 124.78 - 127.53 2 4E4 126.32 71 86 N Carbamylation
K.D(+43.01)SYVGDEAQSKR.G 1.02 2.15 699.3272 35.27 - 42.17 2 3.8E4 38.14 53 64 N Carbamylation
K.R(+43.01)GILTLK.Y 1.41 1.68 422.2760 72.00 - 75.69 2 3.7E4 73.99 64 70 N Carbamylation
K.QEYDEAGPSIVHRK.C 1.34 0.34 543.6108 39.19 - 44.52 3 3.7E4 42.25 362 375 N
K.C(+43.01)DIDIR.K 1.80 0.94 389.1862 45.00 - 49.53 2 3.6E4 47.67 287 292 N Carbamylation
R.G(+43.01)ILTLK.Y 2.68 2.43 344.2268 95.05 - 98.33 2 3.6E4 96.66 65 70 N Carbamylation
K.EITALAP(+31.99)STMK.I 1.39 1.83 597.3163 77.48 - 81.28 2 3.6E4 79.00 318 328 N Dihydroxylation [P]
D.GQVITIGNER.F 1.73 0.40 543.8035 51.46 - 56.20 2 3.6E4 54.08 247 256 N
K.E(-18.01)ITALAPSTMK.I 1.42 2.30 572.3136 92.60 - 96.52 2 3.2E4 94.57 318 328 N Pyro-glu from E
R.V(+43.01)APEEHPTLLTEAPLNPK.A 2.04 3.09 667.0261 101.30 - 103.68 3 3.2E4 102.52 98 115 N Carbamylation
K.IKIIAPPERK.Y 2.96 4.27 582.8823 42.66 - 47.83 2 3.2E4 45.72 329 338 N
K.EITALAPSTMK.I 0.51 0.36 581.3021 67.27 - 72.39 2 2.9E4 69.88 318 328 N
K.DSYVGDEAQS(-18.01)K.R 1.41 3.82 590.7675 33.09 - 37.71 2 2.8E4 35.02 53 63 N Phospho neutral loss (ST)
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.77 2.57 866.1718 129.63 - 131.38 4 2.8E4 129.99 257 286 N Carbamidomethylation
R.HQGVM(+15.99)VGMGQK.D 0.84 2.36 396.5307 33.29 - 36.74 3 2.8E4 34.62 42 52 N Oxidation (M)
R.GILTLKYPIEHGIITNWDDMEK.I 1.51 1.55 647.3425 125.21 - 127.63 4 2.8E4 126.44 65 86 N
K.QEYDEAGPSIVHRK.C 0.81 1.15 407.9596 40.47 - 44.45 4 2.5E4 43.08 362 375 N
R.KDLYANNVLSGGTTMYPGIADR.M 2.10 2.93 1178.5902 96.76 - 99.42 2 2.4E4 98.10 293 314 N
K.A(+42.01)GFAGDDAPR.A 0.59 2.76 509.7410 50.77 - 53.70 2 2.3E4 52.24 21 30 N Acetylation (Protein N-term)
L.TEAPLNPK.A 2.14 2.74 869.4788 32.95 - 37.06 1 2.2E4 35.08 108 115 N
K.C(+42.01)DIDIR.K 1.19 1.26 388.6980 52.62 - 57.54 2 2.2E4 55.00 287 292 N Acetylation (Protein N-term)
R.LDLAGRDLTDYLMK.I 2.15 1.30 541.9571 117.51 - 119.60 3 2.1E4 118.57 180 193 N
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 1.25 1.41 1034.4961 131.02 - 133.30 3 2.1E4 131.52 259 286 N
K.IWHHTFYNELR.V 0.10 3.93 758.3723 66.80 - 71.95 2 1.9E4 67.99 87 97 N
R.A(+43.01)VFPSIVGRPR.H 2.34 2.47 414.5797 98.67 - 101.97 3 1.9E4 100.33 31 41 N Carbamylation
K.EITALAPSTMK.I 0.25 7.04 581.3181 67.57 - 71.05 2 1.7E4 68.82 318 328 N
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 1.11 1.99 1038.4957 132.39 - 134.77 3 1.7E4 132.94 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.51 2.23 1053.4987 130.66 - 132.98 3 1.7E4 131.01 259 286 N Carbamidomethylation
L.SGGTTMYPGIADR.M 1.02 0.65 663.3203 58.35 - 62.27 2 1.6E4 60.51 302 314 N
K.E(+43.01)ITALAPSTMK.I 2.15 4.17 1204.6345 95.75 - 98.31 1 1.5E4 97.19 318 328 N Carbamylation
K.YPIE(+14.02)HGIIT(-18.01)NWDDMEK.I 0.36 0.08 652.9841 105.44 - 107.69 3 1.5E4 106.54 71 86 N Methylation (DE); Phospho neutral loss (ST)
K.E(+43.01)ITALAPSTMK.I 0.15 2.58 602.8177 96.37 - 97.72 2 1.5E4 96.92 318 328 N Carbamylation
Y.ELPDGQVITIGNER.F 0.89 3.69 770.9046 82.39 - 85.00 2 1.5E4 83.70 243 256 N
K.QEYDEAGPSIVHRK.C 1.35 0.00 814.9111 39.22 - 44.48 2 1.4E4 42.17 362 375 N
R.GILTLKYPIE(+14.02)HGIITNWDDMEK.I 1.65 1.54 650.8463 128.42 - 129.43 4 1.4E4 128.86 65 86 N Methylation (DE)
R.MQKEITALAPSTMK.I 1.54 6.57 774.9162 64.04 - 67.97 2 1.3E4 66.24 315 328 N
S.KQEYDEAGPSIVHR.K 0.24 1.50 543.6097 42.05 - 46.47 3 1.2E4 44.80 361 374 N
K.I(+43.01)WHHTFYNELR.V 0.54 1.81 779.8881 105.88 - 107.96 2 1.1E4 107.08 87 97 N Carbamylation
R.GILTLKYPIEHGIITNWDDMEK.I 1.50 1.73 862.7867 125.34 - 127.42 3 1E4 126.39 65 86 N
K.S(+43.01)YELPDGQVITIGNER.F 1.25 0.37 917.4582 120.16 - 122.20 2 1E4 121.09 241 256 N Carbamylation
R.M(+43.01)QKEITALAPSTMK.I 1.02 1.01 796.4158 84.19 - 86.63 2 9.7E3 85.28 315 328 N Carbamylation
C.D(+42.01)DDETTALVCDNGSGLVK.A Y 0.87 2.94 947.4312 95.41 - 99.19 2 9.6E3 97.55 3 20 Y Acetylation (Protein N-term)
K.LCYVALDFENEMATAASSSSLEK.S 0.41 2.48 827.0592 132.44 - 136.09 3 9.4E3 134.00 218 240 N
R.F(+43.01)RCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.66 0.09 862.6655 129.90 - 131.59 4 9.3E3 130.29 257 286 N Carbamylation
K.YPIE(+14.02)HGIITNWDDMEK.I 0.36 0.76 658.9877 95.97 - 98.59 3 9E3 97.13 71 86 N Methylation (DE)
R.HQGVMVGMGQK.D 1.61 1.00 391.1955 106.34 - 109.60 3 8.2E3 107.79 42 52 N
R.V(+43.01)APEEHPTLLTEAPLNPK.A 0.89 2.68 1000.0361 101.50 - 103.64 2 7.7E3 102.64 98 115 N Carbamylation
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.96 0.47 1048.8286 130.75 - 132.02 3 7.7E3 131.27 259 286 N Carbamylation
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.73 2.19 779.1217 132.08 - 132.85 4 7.2E3 132.55 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
R.MQK(+43.01)EITALAPSTMK.I 0.19 3.01 531.2756 83.30 - 85.86 3 7E3 84.73 315 328 N Carbamylation
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.29 0.59 866.1727 129.67 - 131.10 4 7E3 130.22 257 286 N Carbamidomethylation
Y.VALDFENEMATAASSSSLEK.S 0.78 0.15 1050.5045 112.30 - 114.31 2 6.7E3 113.19 221 240 N
K.LC(+57.02)YVALDFENEMATAASSSSLEK.S 0.68 1.04 846.0617 128.85 - 132.28 3 6.6E3 131.09 218 240 N Carbamidomethylation
K.DLYANNVLS(-18.01)GGTTMYPGIADR.M 0.13 5.59 737.3664 115.20 - 117.44 3 5.4E3 116.17 294 314 N Phospho neutral loss (ST)
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 0.17 1.54 1034.4957 128.55 - 133.41 3 5.4E3 131.21 259 286 N
K.IK(+43.01)IIAPPER.K 0.68 0.12 360.5604 53.04 - 56.27 3 5.2E3 54.32 329 337 N Carbamylation
K.D(+42.01)LYANNVLSGGTTMYPGIADR.M 0.33 1.63 568.2629 115.47 - 117.43 4 4.7E3 116.37 294 314 N Acetylation (Protein N-term)
L.ASLSTFQQMWISK.Q 0.35 6.96 763.8839 120.92 - 123.37 2 4.7E3 121.63 349 361 N
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.85 0.68 1135.5436 130.75 - 131.95 3 4.3E3 131.16 257 286 N
R.HQGVMVGMGQK(+43.01)DSYVGDEAQSK.R 0.19 0.12 798.7049 67.69 - 69.52 3 4.2E3 68.43 42 63 N Carbamylation
R.LDLAGRDLTDYLMK.I 0.33 1.31 812.4302 117.64 - 119.21 2 3.7E3 118.64 180 193 N
R.MQK(+43.01)EITALAPSTMK.I 0.02 4.10 796.4299 81.63 - 85.58 2 2.9E3 83.23 315 328 N Carbamylation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.16 0.43 851.9142 130.94 - 131.91 4 2.8E3 131.41 257 286 N
R.HQGVMVGM(+15.99)GQK.D 0.04 1.83 594.2869 30.95 - 32.13 2 2.4E3 31.43 42 52 N Oxidation (M)
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 0.04 5.44 776.1211 131.05 - 131.85 4 1.6E3 131.36 259 286 N
K.QEYDEAGPSIVHRK.C 0.03 0.11 814.9066 43.60 - 46.21 2 1.5E3 44.85 362 375 N
K.EITALAPSTMK(+43.01)IK.I 0.45 3.72 482.6115 90.48 - 91.56 3 1.2E3 90.96 318 330 N Carbamylation
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.02 5.21 1048.8138 131.05 - 132.02 3 1.2E3 131.44 259 286 N Carbamylation
total 137 peptides