| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.GILAADESTGSVAK.R 4.22 2.89 659.8541 52.27 - 57.07 2 6.9E5 54.91 29 42 N
R.ALQASALK.A 4.26 7.67 401.2493 38.88 - 44.48 2 6.1E5 41.52 305 312 N
K.ELSDIAQR.I 3.83 3.82 466.2502 40.67 - 46.54 2 5.7E5 43.52 15 22 N
R.QLLFTADDR.M 3.24 2.18 539.7874 76.42 - 80.30 2 5.3E5 78.08 61 69 N
R.LAIIENANVLAR.Y Y 3.55 6.46 648.8916 96.80 - 100.29 2 5E5 98.14 162 173 Y
R.NMVVGIK.V Y 2.71 4.72 380.7268 51.98 - 56.59 2 4.5E5 54.63 102 108 Y
K.ITPTTPSR.L Y 3.35 7.86 436.7498 30.75 - 34.47 2 4.2E5 32.28 154 161 Y
M.PHSYPFLTPEQK.K Y 2.65 9.17 481.9186 66.12 - 73.56 3 3.9E5 68.87 2 13 N
K.LFPEYLK.G Y 3.11 0.94 455.2616 85.28 - 88.81 2 3.7E5 86.94 93 99 N
R.FQSINAENTEENR.R 3.13 5.54 776.3631 42.07 - 49.04 2 2.2E5 45.44 44 56 N
K.GVVPLAGTNGETTTQGLDGLYER.C 2.50 18.26 783.4055 103.00 - 106.66 3 2E5 104.44 112 134 N
K.DGADFAK.W 2.66 2.88 362.1728 32.05 - 35.32 2 2E5 33.50 141 147 N
M.PHSYPFLTPEQK.K Y 1.84 7.35 722.3750 65.95 - 72.29 2 1.8E5 69.00 2 13 N
K.FSNQEIAMATVTALR.R Y 2.89 7.93 826.4351 110.32 - 114.40 2 1.8E5 111.80 244 258 N
K.FSNQEIAMATVTALR.R Y 3.48 8.44 551.2938 110.58 - 114.85 3 1.7E5 111.80 244 258 N
K.VLAALYK.A Y 3.07 21.40 389.2508 58.90 - 64.04 2 1.6E5 61.57 209 215 N
K.TDN(+.98)GKLFPEYLK.G Y 1.93 9.49 475.9177 85.91 - 89.88 3 1.6E5 87.82 88 99 N Deamidation (NQ)
R.ALQASALK.A 3.44 9.19 801.4905 38.88 - 44.58 1 1.6E5 41.52 305 312 N
R.ALANNQACQGK.Y Y 2.79 5.85 559.2814 29.13 - 31.11 2 1.5E5 29.85 332 342 N
K.ACQEEFMK.R Y 3.36 15.55 493.2151 45.38 - 51.08 2 1.5E5 48.36 323 330 N
K.AC(+57.02)QEEFMK.R Y 2.73 0.35 521.7264 40.08 - 48.67 2 1.4E5 45.18 323 330 N Carbamidomethylation
K.FSNQEIAMATVTALRR.T Y 2.41 6.53 603.3271 102.07 - 105.32 3 1.3E5 103.33 244 259 N
R.ALANNQAC(+57.02)QGK.Y Y 2.62 0.02 587.7915 27.93 - 30.02 2 1.3E5 28.88 332 342 N Carbamidomethylation
K.DGADFAK.W 1.61 1.66 723.3416 32.12 - 36.99 1 1.2E5 33.41 141 147 N
R.Q(-17.03)LLFTADDR.M 2.99 11.04 531.2734 111.20 - 114.13 2 1.2E5 112.64 61 69 N Pyro-glu from Q
K.KELSDIAQR.I 2.38 2.88 530.2987 36.12 - 40.74 2 1E5 38.63 14 22 N
K.VDKGVVPLAGTNGETTTQGLDGLYER.C 3.28 12.98 897.4667 95.51 - 98.41 3 1E5 96.74 109 134 N
K.TDN(+.98)GKLFPEYLK.G Y 1.68 4.56 713.3722 85.88 - 89.45 2 9.4E4 87.76 88 99 N Deamidation (NQ)
K.GVVPLAGTNGETTTQGLDGLYER.C 3.46 10.33 1174.5998 103.00 - 105.79 2 9.3E4 104.43 112 134 N
R.FQSINAENTEENRR.L 2.15 2.25 854.4145 37.53 - 43.60 2 8.1E4 40.81 44 57 N
K.YVSSAASTAGAESLFVANHAY Y 1.85 4.67 706.0116 103.42 - 107.89 3 6.2E4 104.93 343 363 N
R.MNPCIGGVILFHETMYQK.T Y 1.87 2.60 694.3458 128.17 - 130.51 3 5.9E4 128.81 70 87 N
K.ELSDIAQR.I 2.45 6.67 931.4934 40.36 - 46.47 1 5.8E4 43.52 15 22 N
K.A(+43.01)CQEEFMK.R Y 2.85 4.78 514.7185 42.97 - 49.19 2 5.4E4 47.05 323 330 N Carbamylation
M.P(+43.01)HSYPFLTPEQK.K Y 0.64 0.45 743.8713 84.41 - 89.20 2 4.9E4 86.65 2 13 N Carbamylation
K.GVVPLAGTNGETTT(-18.01)QGLDGLYER.C 2.32 9.22 777.3981 105.94 - 108.91 3 4.7E4 107.39 112 134 N Phospho neutral loss (ST)
W.ALTFSYGR.A 1.35 7.16 457.7431 67.62 - 71.55 2 4.6E4 69.37 297 304 N
K.KELSDIAQR.I 2.27 8.52 353.8679 36.15 - 41.01 3 4.6E4 38.64 14 22 N
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK.F Y 1.36 5.68 615.1157 79.56 - 84.12 5 4.2E4 81.41 216 243 N
K.YVSSAASTAGAESLFVANHAY Y 1.81 4.36 1058.5135 103.42 - 108.14 2 4E4 104.91 343 363 N
K.G(+43.01)ILAADESTGSVAK.R 1.36 0.10 681.3567 75.95 - 81.29 2 3.9E4 78.81 29 42 N Carbamylation
K.RCQYVTEK.V 0.66 0.83 513.7716 30.74 - 34.99 2 3.6E4 32.94 201 208 N
R.Q(-17.03)LLFTADDR.M 2.12 9.44 1061.5351 111.14 - 114.21 1 3.5E4 112.64 61 69 N Pyro-glu from Q
K.GILAADESTGSVAK.R 0.64 0.39 659.8509 54.61 - 61.05 2 3.3E4 57.55 29 42 N
K.GVVPLAGTNGE(+21.98)TTTQGLDGLYER.C 2.06 2.35 790.7305 103.04 - 105.91 3 3.1E4 104.43 112 134 N Sodium adduct
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLKR.C Y 1.44 0.57 641.3345 118.08 - 120.32 5 2.8E4 119.28 174 201 N Carbamidomethylation
R.FQSINAENTEENR.R 1.48 1.54 517.9117 43.43 - 47.99 3 2.7E4 45.62 44 56 N
K.LFPEYLK.G Y 1.96 0.27 909.5162 85.45 - 89.36 1 2.6E4 86.94 93 99 N
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.42 3.98 629.9281 123.58 - 126.89 5 2.5E4 124.89 174 201 N
K.ALSDHHVYLEGTLLKPNMVTPGHSC(+57.02)SHK.F Y 1.08 0.72 626.5219 78.70 - 82.44 5 2.3E4 80.59 216 243 N Carbamidomethylation
R.CQYVTEK.V 0.29 5.30 870.4113 31.60 - 37.54 1 1.9E4 33.10 202 208 N
R.N(+43.01)MVVGIK.V Y 1.11 4.35 402.2308 71.09 - 75.48 2 1.8E4 73.27 102 108 N Carbamylation
K.T(-18.01)DN(+.98)GKLFPEYLK.G Y 0.95 3.07 704.3679 85.70 - 88.88 2 1.8E4 87.42 88 99 N Phospho neutral loss (ST); Deamidation (NQ)
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLKR.C Y 0.92 0.91 801.4158 118.32 - 120.59 4 1.7E4 119.42 174 201 N Carbamidomethylation
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK.F Y 0.87 5.23 768.6411 79.80 - 83.31 4 1.6E4 81.49 216 243 N
K.ALSDHHVYLEGTLLKPNMVTPGHSC(+57.02)SHK.F Y 0.79 0.01 782.8965 79.12 - 82.57 4 1.6E4 80.50 216 243 N Carbamidomethylation
K.E(-18.01)LSDIAQR.I 0.66 0.10 457.2447 40.54 - 46.21 2 1.5E4 43.33 15 22 N Pyro-glu from E
R.LAIIENANVLAR.Y Y 1.87 2.90 432.9312 96.83 - 100.50 3 1.5E4 98.16 162 173 N
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.02 3.39 787.1575 123.67 - 125.94 4 1.4E4 124.68 174 201 N
K.AC(+57.02)QEEFMKR.A Y 0.36 0.13 599.7770 36.25 - 43.60 2 1.3E4 39.11 323 331 N Carbamidomethylation
R.C(+57.02)QYVTEK.V 0.42 1.73 464.2184 30.57 - 32.81 2 1.3E4 31.64 202 208 N Carbamidomethylation
K.FSNQE(+21.98)IAMATVTALR.R Y 1.65 0.19 558.6198 110.56 - 112.79 3 1.1E4 111.83 244 258 N Sodium adduct
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.46 6.31 638.5299 120.37 - 122.83 5 1.1E4 121.58 174 201 N Carbamylation
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.12 3.08 797.9064 120.32 - 122.91 4 1.1E4 121.57 174 201 N Carbamylation
H.GIVPIVEPEILPDGDHDLKR.C Y 1.09 1.30 553.8090 107.79 - 110.13 4 9.6E3 109.25 182 201 N
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK(+43.01).F Y 0.30 2.11 623.7158 79.51 - 82.82 5 7.9E3 80.87 216 243 N Carbamylation
R.L(+43.01)AIIENANVLAR.Y Y 1.84 4.51 670.3934 133.49 - 134.14 2 7.7E3 133.71 162 173 N Carbamylation
K.GILAADESTGSVAKR.F 0.15 2.77 737.8994 46.90 - 51.19 2 7.7E3 49.57 29 43 N
M.PHSYPFLTPEQK.K Y 0.12 4.40 722.3561 64.15 - 70.79 2 6.9E3 66.42 2 13 N
K.VDKGVVPLAGTNGETTTQGLDGLYER.C 0.13 2.98 673.3503 95.59 - 97.39 4 5.9E3 96.80 109 134 N
R.MNPCIGGVILFHETMYQK.T Y 0.81 2.32 1041.0120 128.19 - 130.48 2 5.8E3 128.86 70 87 N
K.I(+43.01)TPTTPSR.L Y 0.06 5.69 458.2583 44.93 - 50.72 2 5.6E3 47.76 154 161 N Carbamylation
R.NMVVGIKVDK.G Y 0.13 1.87 368.2178 57.68 - 61.14 3 5.5E3 60.18 102 111 N
R.CQYVTEK.V 0.03 5.30 870.4119 31.38 - 35.70 1 5.5E3 33.52 202 208 N
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLK.R Y 0.66 2.44 762.3822 125.38 - 127.03 4 4.7E3 126.39 174 200 N Carbamidomethylation
K.GVVPLAGTNGE(+21.98)TTTQGLDGLYER.C 0.05 1.35 790.7325 103.95 - 106.33 3 3.6E3 104.62 112 134 N Sodium adduct
K.G(+43.01)VVPLAGTNGETTTQGLDGLYER.C 0.23 5.17 797.7352 118.00 - 119.84 3 3.1E3 118.84 112 134 N Carbamylation
K.YVSSAASTAGAESLFVANHAY Y 0.42 0.20 1058.5236 104.63 - 108.55 2 3E3 107.05 343 363 N
R.YASICQMHGIVPIVEPEILPDGDHDLK.R Y 0.12 2.32 748.1320 128.91 - 130.07 4 2.9E3 129.27 174 200 N
K.V(+43.01)LAALYK.A Y 0.94 2.19 410.7551 128.58 - 129.80 2 958.5 129.13 209 215 N Carbamylation
total 80 peptides