| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.SGVGNIFIK.N 2.70 2.32 467.7758 81.61 - 85.24 2 9.1E4 83.49 96 104 N
R.ALDTMNFDVIK.G 2.08 3.09 633.8292 105.21 - 108.54 2 8.9E4 107.05 68 78 N
R.GFGFVSFER.H 2.28 1.52 523.2642 106.98 - 110.11 2 7.9E4 108.44 232 240 N
R.IVATKPLYVALAQR.K 2.89 6.23 514.9888 85.28 - 88.37 3 7.6E4 86.97 357 370 N
K.MNGMLLNDR.K 1.71 1.84 532.2594 63.91 - 68.04 2 7.3E4 66.27 158 166 N
R.YQGVNLYVK.N 2.12 2.81 542.3007 68.70 - 72.03 2 6.6E4 70.57 291 299 N
K.AVTEMNGR.I 1.18 0.78 439.2200 29.31 - 31.88 2 5.7E4 30.85 349 356 N
R.LFPLIQNMHPSLTGK.I Y 2.15 2.73 565.9845 117.13 - 120.45 3 4.1E4 118.93 569 583 Y
R.IMWSQR.D 1.90 4.55 410.7146 50.15 - 55.14 2 4.1E4 52.86 84 89 N
R.SKVDEAVAVLQAHQAK.E 1.53 3.09 565.3167 66.16 - 69.79 3 4E4 68.19 608 623 N
R.Q(-17.03)AHLTNQYMQR.M 1.47 1.83 686.8308 51.49 - 56.38 2 3.1E4 54.35 375 385 N Pyro-glu from Q
K.NLDDGIDDER.L 2.45 4.01 581.2609 47.63 - 52.56 2 2.9E4 50.33 300 309 N
K.VMMEGGR.S 0.92 1.33 390.1867 30.84 - 34.68 2 2.9E4 32.91 325 331 N
K.NFGEDMDEEK.L Y 2.44 0.28 607.2444 45.07 - 50.08 2 2.6E4 47.89 197 206 Y
F.MAAIPQAQNR.A 1.16 0.40 550.2919 39.47 - 44.62 2 2.6E4 42.48 410 419 N
K.EFTNVYVK.N Y 1.49 0.91 500.2634 58.15 - 62.45 2 2.6E4 60.74 189 196 Y
K.GFGFVCFSSPEEATK.A 1.66 9.18 803.3718 119.76 - 122.16 2 2.3E4 120.95 334 348 N
K.EFTPFGTITSAK.V Y 1.99 1.42 649.8400 98.06 - 100.83 2 2.2E4 99.58 313 324 N
K.AVDDLNGK.E Y 0.36 1.43 416.2239 31.26 - 33.87 2 1.9E4 32.64 247 254 N
R.IVATKPLYVALAQR.K 2.11 3.09 771.9780 85.28 - 88.81 2 1.7E4 86.97 357 370 N
R.SLGYAYVNFQQPADAER.A 1.85 4.91 964.9663 92.94 - 95.82 2 1.7E4 94.26 51 67 N
R.EAELGAR.A 1.03 1.81 745.3893 28.78 - 32.82 1 1.7E4 31.02 180 186 N
K.GFGFVC(+57.02)FSSPEEATK.A 1.93 1.25 831.8845 111.41 - 114.08 2 1.6E4 112.87 334 348 N Carbamidomethylation
R.QAHLTNQYMQR.M 1.42 1.42 695.3441 38.31 - 43.74 2 1.5E4 41.08 375 385 N
R.SLGYAYVNFQQPADAER.A 0.72 0.03 643.6471 93.22 - 95.82 3 1.3E4 94.26 51 67 N
Y.VGDLHQDVTEAMLYEK.F Y 0.80 1.77 616.6395 88.70 - 90.93 3 1.3E4 89.73 15 30 N
R.KFEQMK.Q 0.34 0.93 405.7175 29.76 - 31.37 2 1.3E4 30.44 279 284 N
P.EEATK.A 0.50 6.82 577.2806 29.52 - 31.53 1 1.3E4 30.25 344 348 N
R.KEFTPFGTITSAK.V Y 1.22 0.86 476.2623 82.15 - 85.07 3 1.3E4 83.75 312 324 N
Y.AYVNFQQPADAER.A 0.76 0.32 754.8680 63.30 - 67.77 2 1.2E4 65.66 55 67 N
K.FSPAGAILSIR.V Y 1.47 3.77 566.3350 111.41 - 113.93 2 9.4E3 112.75 31 41 N
F.SAFGNILSCK(+43.01).V 0.54 2.90 541.7765 86.28 - 91.17 2 8.2E3 87.98 120 129 N Carbamylation
R.SKVDEAVAVLQAHQAK.E 0.45 3.34 424.2402 66.41 - 69.75 4 7.3E3 68.39 608 623 N
R.ALDTMNFDVIK.G 0.30 0.69 633.8319 104.09 - 107.27 2 6.9E3 105.32 68 78 N
K.GFGFVCFSSPEEATK(+43.01).A 0.39 4.78 824.8811 115.65 - 119.65 2 6.5E3 117.46 334 348 N Carbamylation
R.DMITR.R 0.05 5.39 318.1679 33.06 - 35.46 2 5.2E3 34.18 45 49 N
K.MNGMLLNDRK.V 0.17 5.93 397.8770 50.09 - 53.76 3 4.6E3 52.03 158 167 N
K.GFGFVCFSSPEEATK.A 0.32 0.85 803.3647 117.96 - 122.31 2 3.5E3 120.38 334 348 N
R.NPQQHMPAQPVPMQQPAVHVQGQEPLTASMLAAAPPQEQK.Q Y 0.44 7.35 1078.3036 98.75 - 101.02 4 2.9E3 100.12 523 562 N
K.ALYDTFSAFGNILSCK.V 0.55 3.00 875.4332 134.05 - 134.88 2 2.6E3 134.55 114 129 N
total 40 peptides