| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.LSGPVFNVVK.Y Y 2.92 1.41 530.3196 87.45 - 90.61 2 1.1E6 88.88 114 123 Y
K.ILAGSSADMNINGPK.I Y 1.28 0.79 744.3891 63.68 - 71.22 2 7E5 65.69 45 59 Y
K.ALVVVVGSGLGSK.L Y 2.00 0.10 593.3708 84.54 - 89.28 2 4E5 86.24 101 113 Y
K.LAVCVGQSNK.A Y 2.20 2.60 509.7784 43.78 - 51.20 2 4E5 47.33 91 100 N
W.SSTPGLTGVTAPQIK.I Y 2.41 2.02 728.9119 74.88 - 77.77 2 2.5E5 76.69 30 44 N
K.LAVC(+57.02)VGQSNK.A Y 1.84 2.07 538.2891 41.49 - 48.78 2 1.7E5 45.43 91 100 N Carbamidomethylation
M.S(+42.01)WDAYR.D Y 1.60 0.13 839.3782 71.36 - 75.58 1 1.7E5 73.34 2 7 N Acetylation (Protein N-term)
K.L(+43.01)AVCVGQSNK.A Y 1.65 0.35 531.2813 42.50 - 49.16 2 1.3E5 46.10 91 100 N Carbamylation
M.S(+42.01)WDAYR.D Y 2.06 0.70 420.1933 71.39 - 75.51 2 1E5 73.33 2 7 N Acetylation (Protein N-term)
K.ILAGSSADMNINGPK.I Y 0.80 1.24 496.5941 63.28 - 68.34 3 5.4E4 65.90 45 59 N
K.C(+57.02)MLLR.D Y 2.08 1.37 346.6863 52.13 - 57.58 2 4.5E4 54.81 65 69 N Carbamidomethylation
K.LSGPVFNVVK.Y Y 1.91 2.48 1059.6308 87.39 - 90.30 1 3.7E4 88.88 114 123 N
K.ALVVVVGSGLGSK.L Y 0.47 0.10 593.3692 87.97 - 96.04 2 3.6E4 90.43 101 113 N
K.ALVVVVGSGLGSK.L Y 0.67 3.05 593.3648 83.92 - 89.21 2 3.1E4 85.85 101 113 N
R.QDTQSFCMHLK.T Y 0.71 0.49 669.3105 62.73 - 68.75 2 2.5E4 65.57 73 83 N
R.QDTQSFC(+57.02)MHLK.T Y 1.96 60.00 465.5519 59.86 - 63.94 3 2.4E4 61.68 73 83 N Carbamidomethylation
K.L(+43.01)SGPVFNVVK.Y Y 1.85 0.56 551.8233 118.17 - 120.46 2 2.3E4 119.61 114 123 N Carbamylation
R.QDTQSFCMHLK.T Y 1.31 11.67 446.5440 65.49 - 70.09 3 2.2E4 67.31 73 83 N
W.SSTPGLTGVTAPQIK.I Y 0.48 1.17 486.2772 75.61 - 79.76 3 2.2E4 77.30 30 44 N
R.QDTQSFCMHLK(+43.01).T Y 0.57 8.06 460.8798 60.13 - 64.45 3 9.9E3 62.44 73 83 N Carbamylation
K.LAVCVGQSNK.A Y 0.12 2.14 1018.5434 43.92 - 49.62 1 7.8E3 47.12 91 100 N
K.LSGPVFNVVK.Y Y 0.03 0.38 530.3177 88.39 - 89.48 2 5.8E3 89.01 114 123 N
R.QDTQSFCMHLK.T Y 0.08 1.83 669.3189 65.55 - 67.96 2 5.8E3 67.11 73 83 N
K.C(+43.01)MLLR.D Y 0.32 5.68 339.6787 54.07 - 57.60 2 4.9E3 55.95 65 69 N Carbamylation
K.ALVVVVGSGLGSK.L Y 0.04 0.99 593.3729 85.96 - 87.54 2 2.9E3 86.93 101 113 N
R.DQLTAVESVTEAGIFGLDGSTWSSTPGLTGVTAPQIK.I Y 0.52 0.26 934.2334 135.06 - 135.81 4 2.5E3 135.35 8 44 N
total 26 peptides