| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.GILAADESTGSVAK.R 2.71 1.92 659.8552 52.87 - 60.83 2 6.8E5 55.66 29 42 N
R.ALQASALK.A 2.81 5.51 401.2501 38.88 - 45.52 2 6E5 42.19 305 312 N
R.QLLFTADDR.M 2.33 0.02 539.7890 76.47 - 80.97 2 5.8E5 78.42 61 69 N
R.LAIIENANVLAR.Y Y 2.50 2.36 648.8926 96.90 - 100.29 2 5.5E5 98.43 162 173 Y
K.ELSDIAQR.I 2.84 5.22 466.2513 40.57 - 47.89 2 5.3E5 44.27 15 22 N
K.LFPEYLK.G Y 2.33 2.76 455.2627 85.51 - 89.19 2 4.9E5 87.39 93 99 Y
K.ITPTTPSR.L Y 2.23 2.62 436.7509 30.85 - 35.62 2 4.6E5 32.84 154 161 Y
R.NMVVGIK.V Y 2.30 3.47 380.7279 52.81 - 57.75 2 4.5E5 55.31 102 108 N
M.PHSYPFLTPEQK.K Y 1.81 2.29 481.9200 67.27 - 73.56 3 3.9E5 69.74 2 13 N
K.GVVPLAGTNGETTTQGLDGLYER.C 2.63 0.76 783.4062 103.00 - 106.66 3 2.9E5 104.70 112 134 N
K.RFQSINAENTEENR.R 2.09 3.53 569.9469 37.44 - 45.03 3 2.7E5 41.59 43 56 N
R.FQSINAENTEENR.R 1.89 2.97 776.3646 41.72 - 50.56 2 2.1E5 46.19 44 56 N
K.FSNQEIAMATVTALR.R Y 2.06 0.45 826.4364 110.32 - 114.40 2 2.1E5 112.11 244 258 N
K.DGADFAK.W 1.70 1.71 362.1739 32.33 - 36.29 2 2.1E5 34.00 141 147 N
K.FSNQEIAMATVTALR.R Y 2.23 1.41 551.2954 110.58 - 114.88 3 1.9E5 112.11 244 258 N
M.PHSYPFLTPEQK.K Y 1.31 2.94 722.3785 67.47 - 72.29 2 1.9E5 69.63 2 13 N
R.ALANNQACQGK.Y Y 1.67 1.44 559.2823 29.13 - 31.59 2 1.7E5 30.17 332 342 N
K.VLAALYK.A Y 1.87 3.87 389.2516 59.89 - 64.32 2 1.7E5 62.22 209 215 N
K.ACQEEFMK.R Y 2.17 4.06 493.2167 45.38 - 52.27 2 1.7E5 49.05 323 330 N
R.ALQASALK.A 2.33 2.10 801.4929 38.91 - 45.55 1 1.6E5 42.19 305 312 N
K.DGADFAK.W 1.25 1.10 723.3414 32.23 - 37.21 1 1.3E5 33.97 141 147 N
K.FSNQEIAMATVTALRR.T Y 1.66 8.16 603.3286 102.07 - 105.32 3 1.2E5 103.56 244 259 N
K.AC(+57.02)QEEFMK.R Y 1.81 1.59 521.7282 40.22 - 48.95 2 1.2E5 45.89 323 330 N Carbamidomethylation
K.VDKGVVPLAGTNGETTTQGLDGLYER.C 2.04 4.32 897.4680 95.59 - 98.41 3 1E5 97.03 109 134 N
R.Q(-17.03)LLFTADDR.M 1.80 9.27 531.2737 111.20 - 114.13 2 1E5 112.91 61 69 N Pyro-glu from Q
K.TDN(+.98)GKLFPEYLK.G Y 2.05 55.79 475.9198 87.12 - 89.88 3 1E5 88.31 88 99 N Deamidation (NQ)
K.GVVPLAGTNGETTTQGLDGLYER.C 2.16 3.00 1174.5997 103.00 - 105.79 2 9.8E4 104.70 112 134 N
R.ALANNQAC(+57.02)QGK.Y Y 1.50 4.70 587.7935 27.93 - 29.93 2 9.6E4 29.08 332 342 N Carbamidomethylation
K.KELSDIAQR.I 1.78 2.55 530.3001 36.15 - 42.43 2 9.6E4 39.36 14 22 N
R.FQSINAENTEENRR.L 1.62 2.75 854.4162 37.34 - 45.27 2 8.1E4 41.59 44 57 N
K.TDN(+.98)GKLFPEYLK.G Y 0.50 8.34 713.3747 86.40 - 89.45 2 6.8E4 87.98 88 99 N Deamidation (NQ)
K.YVSSAASTAGAESLFVANHAY Y 1.59 1.90 706.0147 103.42 - 107.89 3 6.6E4 105.20 343 363 N
K.A(+43.01)CQEEFMK.R Y 1.81 0.35 514.7200 44.36 - 50.80 2 6.6E4 47.78 323 330 N Carbamylation
R.MNPCIGGVILFHETMYQK.T Y 1.31 1.94 694.3486 128.18 - 130.75 3 6.1E4 128.97 70 87 N
K.ELSDIAQR.I 2.00 1.85 931.4958 40.36 - 47.62 1 6E4 44.26 15 22 N
R.CQYVTEK.V 1.15 2.71 435.7110 31.60 - 36.12 2 5.9E4 33.46 202 208 N
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK.F Y 1.44 3.04 615.1164 79.56 - 84.16 5 5.4E4 81.81 216 243 N
M.P(+43.01)HSYPFLTPEQK.K Y 0.50 0.11 743.8781 86.17 - 89.20 2 5.3E4 87.23 2 13 N Carbamylation
W.ALTFSYGR.A 0.65 3.53 457.7453 68.05 - 71.55 2 4.5E4 69.79 297 304 N
K.GVVPLAGTNGETTT(-18.01)QGLDGLYER.C 1.68 6.15 777.3997 105.94 - 108.91 3 4.5E4 107.65 112 134 N Phospho neutral loss (ST)
K.KELSDIAQR.I 1.54 3.69 353.8687 36.18 - 42.23 3 4.3E4 39.11 14 22 N
K.G(+43.01)ILAADESTGSVAK.R 1.35 0.53 681.3572 77.54 - 81.40 2 4.3E4 79.17 29 42 N Carbamylation
K.YVSSAASTAGAESLFVANHAY Y 1.55 3.24 1058.5154 103.42 - 108.14 2 4.2E4 105.18 343 363 N
K.LFPEYLK.G Y 1.74 4.57 909.5186 85.58 - 89.36 1 3.6E4 87.39 93 99 N
K.GVVPLAGTNGE(+21.98)TTTQGLDGLYER.C 1.71 0.60 790.7330 103.04 - 105.91 3 3.5E4 104.70 112 134 N Sodium adduct
R.Q(-17.03)LLFTADDR.M 1.43 8.71 1061.5366 111.14 - 114.21 1 3.1E4 112.86 61 69 N Pyro-glu from Q
R.FQSINAENTEENR.R 1.61 0.78 517.9131 42.16 - 49.57 3 3.1E4 46.21 44 56 N
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.90 0.25 629.9293 123.58 - 126.89 5 2.9E4 125.22 174 201 N
K.GILAADESTGSVAK.R 0.20 1.88 659.8529 55.22 - 61.05 2 2.6E4 57.92 29 42 N
R.N(+43.01)MVVGIK.V Y 1.00 0.89 402.2313 71.86 - 75.48 2 2.5E4 73.64 102 108 N Carbamylation
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLKR.C Y 1.19 3.14 641.3353 118.08 - 120.32 5 2.3E4 119.49 174 201 N Carbamidomethylation
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK.F Y 0.65 1.66 768.6425 79.80 - 83.31 4 2E4 81.42 216 243 N
K.ALSDHHVYLEGTLLKPNMVTPGHSC(+57.02)SHK.F Y 0.78 2.04 626.5233 78.70 - 82.59 5 1.9E4 80.86 216 243 N Carbamidomethylation
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.85 0.50 787.1578 123.67 - 126.35 4 1.9E4 124.95 174 201 N
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.28 0.53 638.5314 120.38 - 122.83 5 1.9E4 121.84 174 201 N Carbamylation
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.13 0.40 797.9077 120.40 - 122.97 4 1.7E4 121.96 174 201 N Carbamylation
R.LAIIENANVLAR.Y Y 1.54 0.76 432.9316 96.97 - 100.50 3 1.7E4 98.44 162 173 N
R.CQYVTEK.V 0.28 3.18 870.4145 31.38 - 37.54 1 1.5E4 33.12 202 208 N
R.LAIIENANVLAR.Y Y 0.24 5.02 648.8920 98.53 - 104.91 2 1.4E4 99.61 162 173 N
R.ALANNQACQGK.Y Y 0.07 2.27 559.2840 29.79 - 32.67 2 1.3E4 30.99 332 342 N
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLKR.C Y 0.56 0.47 801.4179 118.93 - 120.59 4 1.2E4 119.85 174 201 N Carbamidomethylation
K.T(-18.01)DN(+.98)GKLFPEYLK.G Y 0.18 5.78 704.3704 86.94 - 88.88 2 1.2E4 88.05 88 99 N Phospho neutral loss (ST); Deamidation (NQ)
K.ALSDHHVYLEGTLLKPNMVTPGHSC(+57.02)SHK.F Y 0.26 1.39 782.8990 79.12 - 82.57 4 1.2E4 80.54 216 243 N Carbamidomethylation
G.T(+43.01)NGETTTQGLDGLYER.C 0.74 0.07 899.4142 95.22 - 99.14 2 1.2E4 96.92 119 134 N Carbamylation
H.GIVPIVEPEILPDGDHDLKR.C Y 0.89 1.74 553.8113 108.66 - 110.30 4 1.2E4 109.50 182 201 N
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK(+43.01).F Y 0.11 0.27 623.7188 79.59 - 82.82 5 1.1E4 80.95 216 243 N Carbamylation
R.L(+43.01)AIIENANVLAR.Y Y 1.46 0.28 670.3941 133.53 - 134.42 2 1.1E4 133.75 162 173 N Carbamylation
R.C(+57.02)QYVTEK.V 0.22 0.44 464.2214 31.36 - 33.36 2 9E3 32.45 202 208 N Carbamidomethylation
K.G(+43.01)VVPLAGTNGETTTQGLDGLYER.C 0.61 1.08 797.7347 117.90 - 119.84 3 8.2E3 118.78 112 134 N Carbamylation
K.I(+43.01)TPTTPSR.L Y 0.11 1.45 458.2578 44.93 - 50.72 2 8.1E3 48.14 154 161 N Carbamylation
K.FSNQEIAMATVTALRR.T Y 1.02 1.86 904.4840 102.14 - 104.71 2 7.7E3 103.46 244 259 N
K.GILAADESTGSVAKR.F 0.10 3.75 737.9020 46.90 - 51.19 2 7.4E3 49.45 29 43 N
K.VDKGVVPLAGTNGETTTQGLDGLYER.C 0.11 1.53 673.3531 95.59 - 97.39 4 7E3 96.71 109 134 N
K.RALANNQACQGK.Y Y 0.41 2.11 637.3351 27.52 - 29.66 2 6.8E3 28.60 331 342 N
K.AC(+57.02)QEEFMKR.A Y 0.06 5.38 599.7796 36.84 - 42.63 2 6.4E3 39.18 323 331 N Carbamidomethylation
R.MNPCIGGVILFHETMYQK.T Y 0.65 1.61 1041.0110 126.59 - 130.48 2 6.4E3 128.54 70 87 N
R.ALANNQAC(+45.99)QGK(+43.01).Y Y 0.15 2.81 603.7864 27.30 - 33.75 2 6.1E3 29.86 332 342 N Beta-methylthiolation; Carbamylation
K.RFQSINAENTEENRR.L 0.04 0.01 466.7439 36.86 - 39.95 4 6E3 38.10 43 57 N
K.F(+43.01)SNQEIAMATVTALR.R Y 0.48 0.86 847.9383 131.30 - 131.85 2 4.5E3 131.63 244 258 N Carbamylation
R.NMVVGIKVDK.G Y 0.05 5.36 368.2188 57.68 - 61.09 3 4.2E3 60.00 102 111 N
R.A(+43.01)LANNQACQGK.Y Y 0.07 0.80 580.8008 40.24 - 44.03 2 4.2E3 42.70 332 342 N Carbamylation
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.39 1.16 1049.2039 123.77 - 126.21 3 3.8E3 125.02 174 201 N
K.K(+43.01)ELSDIAQR.I 0.03 5.36 551.8075 56.33 - 59.67 2 3.5E3 58.26 14 22 N Carbamylation
R.YASICQMHGIVPIVEPEILPDGDHDLK.R Y 0.15 1.82 748.1340 128.91 - 130.07 4 3.1E3 129.33 174 200 N
K.L(+43.01)FPEYLK.G Y 0.34 2.74 476.7642 126.12 - 130.13 2 2.6E3 129.19 93 99 N Carbamylation
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.07 0.14 797.9119 130.91 - 132.15 4 2.1E3 131.42 174 201 N Carbamylation
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLK.R Y 0.09 1.60 762.3836 125.38 - 127.03 4 1.6E3 126.38 174 200 N Carbamidomethylation
K.V(+43.01)LAALYK.A Y 0.81 0.47 410.7550 128.58 - 129.80 2 1.5E3 129.29 209 215 N Carbamylation
K.F(+43.01)SNQEIAMATVTALRR.T Y 0.17 0.05 617.6602 124.69 - 127.45 3 1.4E3 126.03 244 259 N Carbamylation
total 89 peptides