| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
R.ALDTMNFDVIK.G 1.72 3.83 633.8311 105.21 - 108.54 2 9.8E4 107.30 68 78 N
K.SGVGNIFIK.N 1.83 3.30 467.7766 81.86 - 85.24 2 8.3E4 83.79 96 104 N
R.IVATKPLYVALAQR.K 1.91 2.57 514.9905 86.06 - 88.37 3 8E4 87.34 357 370 N
K.MNGMLLNDR.K 1.63 0.23 532.2620 64.58 - 68.41 2 8E4 66.78 158 166 N
R.GFGFVSFER.H 1.91 2.11 523.2646 107.02 - 110.39 2 7.9E4 108.82 232 240 N
R.YQGVNLYVK.N 1.40 3.33 542.3023 69.05 - 72.05 2 6.2E4 71.03 291 299 N
R.SKVDEAVAVLQAHQAK.E 1.52 5.17 565.3179 66.79 - 69.89 3 4.3E4 68.61 608 623 N
R.IMWSQR.D 1.40 2.18 410.7149 50.65 - 55.94 2 4.2E4 53.43 84 89 N
R.LFPLIQNMHPSLTGK.I 1.49 9.28 565.9844 117.13 - 120.45 3 3.5E4 119.26 569 583 N
K.NLDDGIDDER.L 1.59 1.14 581.2630 47.64 - 53.91 2 3E4 51.02 300 309 N
R.Q(-17.03)AHLTNQYMQR.M 1.21 3.67 686.8343 52.61 - 57.48 2 2.7E4 55.18 375 385 N Pyro-glu from Q
K.EFTPFGTITSAK.V 1.44 1.06 649.8412 98.38 - 101.52 2 2.7E4 99.98 313 324 N
K.NFGEDMDEEK.L 1.84 0.08 607.2456 45.11 - 51.75 2 2.7E4 48.62 197 206 N
K.AVDDLNGK.E 0.68 0.06 416.2246 31.26 - 34.57 2 2.6E4 33.10 247 254 N
K.GFGFVCFSSPEEATK.A 1.35 3.41 803.3734 119.76 - 122.20 2 2.6E4 121.26 334 348 N
K.EFTNVYVK.N 1.46 0.32 500.2655 58.92 - 63.12 2 2.4E4 61.25 189 196 N
R.IVATKPLYVALAQR.K 1.67 1.83 771.9807 86.09 - 88.81 2 1.9E4 87.41 357 370 N
R.SLGYAYVNFQQPADAER.A 1.42 1.20 964.9717 92.94 - 96.49 2 1.9E4 94.53 51 67 N
Y.VGDLHQDVTEAMLYEK.F 1.41 0.08 616.6399 88.71 - 91.09 3 1.8E4 90.04 15 30 N
R.QAHLTNQYMQR.M 1.33 0.23 695.3450 37.65 - 45.65 2 1.8E4 41.98 375 385 N
P.EEATK.A 0.34 3.65 577.2809 29.52 - 31.53 1 1.5E4 30.34 344 348 N
R.SLGYAYVNFQQPADAER.A 0.47 0.00 643.6512 93.81 - 95.82 3 1.4E4 94.50 51 67 N
F.SAFGNILSCK(+43.01).V 1.02 0.23 541.7761 86.64 - 91.17 2 1.2E4 88.31 120 129 N Carbamylation
K.GFGFVC(+57.02)FSSPEEATK.A 1.50 5.43 831.8878 111.51 - 114.08 2 1.2E4 113.21 334 348 N Carbamidomethylation
Y.AYVNFQQPADAER.A 0.53 0.36 754.8712 63.81 - 67.94 2 1.2E4 66.00 55 67 N
R.KEFTPFGTITSAK.V 0.61 1.52 476.2647 82.46 - 85.08 3 1.1E4 83.92 312 324 N
K.FSPAGAILSIR.V 1.16 1.46 566.3351 111.41 - 114.11 2 1E4 113.10 31 41 N
R.DMITR.R 0.09 0.49 318.1669 33.06 - 35.46 2 9.1E3 34.14 45 49 N
K.GFGFVCFSSPEEATK(+43.01).A 0.77 1.86 824.8780 115.65 - 117.95 2 8.6E3 117.11 334 348 N Carbamylation
R.SKVDEAVAVLQAHQAK.E 0.24 6.57 424.2408 66.41 - 69.75 4 6.2E3 68.52 608 623 N
K.MNGMLLNDRK.V 0.15 5.79 397.8770 50.09 - 53.76 3 4.7E3 52.03 158 167 N
R.NPQQHMPAQPVPMQQPAVHVQGQEPLTASMLAAAPPQEQK.Q Y 0.78 9.38 1078.3036 98.75 - 101.02 4 2.9E3 100.12 523 562 Y
K.ALYDTFSAFGNILSCK.V 0.29 7.01 875.4385 134.05 - 136.45 2 2.2E3 135.14 114 129 N
Y.VGDLHQDVTEAMLYEK.F 0.03 2.31 616.6390 88.71 - 90.50 3 1.5E3 89.22 15 30 N
K.GFGFVCFSSPEEATK.A 0.08 1.16 803.3878 119.68 - 122.64 2 808.4 121.64 334 348 N
total 35 peptides