| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.GASQAGMTAPGTR.R 1.14 0.70 602.7916 32.01 - 41.44 2 8.7E4 35.07 213 225 N
R.VDIGVK.Y Y 1.75 0.97 315.6949 39.95 - 49.57 2 6.2E4 43.33 138 143 Y
K.GPSFGLSAEIK.N Y 1.25 0.55 553.2979 83.87 - 89.77 2 3.9E4 86.23 7 17 Y
R.MFDEEK.M Y 0.83 3.44 399.6715 35.98 - 45.18 2 3.5E4 38.97 151 156 Y
K.AGQCVIGLQMGTNK.C Y 1.56 1.67 710.3576 79.92 - 85.77 2 2.8E4 82.34 159 172 N
R.HLYDPK.V 0.64 0.58 386.7030 31.68 - 37.84 2 2E4 33.14 187 192 N
K.AGQC(+57.02)VIGLQMGTNK.C Y 1.21 5.85 738.8700 73.83 - 78.81 2 1.7E4 76.05 159 172 N Carbamidomethylation
K.INQSALNWHQLENLTNFIK.A Y 2.12 2.23 761.7340 131.51 - 132.60 3 1.6E4 132.10 73 91 N
K.YDSQKEDELR.V Y 1.45 2.84 641.8016 30.92 - 40.84 2 1.4E4 33.24 24 33 N
K.VQIQPPMDNTTISLQMGTNK.G Y 0.32 1.35 739.3696 102.24 - 106.14 3 9.7E3 103.68 193 212 N
K.AGQCVIGLQMGTNK.C Y 0.13 0.19 710.3551 81.47 - 85.26 2 8.7E3 83.13 159 172 N
K.AGEVAEDQNGAGVVPDYIPDFQDEGYQGYQEEEQVYR.E Y 1.14 1.55 1041.9570 124.01 - 126.65 4 8.6E3 125.19 275 311 N
K.A(+43.01)GQCVIGLQMGTNK.C Y 0.31 0.00 731.8630 76.26 - 80.63 2 8.2E3 78.32 159 172 N Carbamylation
K.SGVILCTLINHLAPGSVK.K Y 1.12 0.42 608.0038 130.80 - 132.43 3 7.4E3 131.49 54 71 N
K.GPSFGLSAEIK.N Y 0.15 4.19 553.2989 83.26 - 87.07 2 7.2E3 84.78 7 17 N
R.VWIEELTGASIGSDFQK.G Y 1.15 0.11 627.3195 128.20 - 129.37 3 7E3 128.78 34 50 N
R.RHLYDPK.V 0.60 0.88 310.1715 29.56 - 31.29 3 6.2E3 30.60 186 192 N
K.GASQAGMTAPGTRR(+.98).A 0.07 5.32 681.3315 33.36 - 42.04 2 4.2E3 36.44 213 226 N Citrullination
K.YDSQKEDELR.V Y 0.58 9.36 428.2006 32.22 - 38.94 3 4E3 34.53 24 33 N
K.SGVILC(+57.02)TLINHLAPGSVK.K Y 1.55 14.52 627.0216 130.30 - 131.16 3 4E3 130.71 54 71 N Carbamidomethylation
R.RAIYDQK.L Y 0.25 0.10 447.2467 30.29 - 31.91 2 4E3 31.21 226 232 N
K.SGVILCTLINHLAPGSVK.K Y 0.29 1.20 608.0120 129.63 - 132.23 3 3.3E3 131.50 54 71 N
K.GPSFGLSAEIK.N Y 0.04 5.50 553.2838 81.44 - 85.22 2 2.5E3 83.35 7 17 N
total 23 peptides