| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
Y.MVGPIEEVVLK.A Y 3.04 10.15 607.3451 103.73 - 108.02 2 3.6E5 105.77 512 522 Y
R.IMDPNIVGTEHYEIAR.G Y 1.85 2.32 619.9770 82.63 - 87.59 3 2.5E5 84.55 410 425 Y
R.IPVGPETLGR.I Y 3.74 7.83 519.8007 63.30 - 70.63 2 2.5E5 66.24 137 146 Y
R.TIAMDGTEGLVR.G Y 2.97 5.91 631.8260 73.80 - 78.88 2 2.3E5 75.74 113 124 N
K.VLDTGAPIR.I Y 2.55 3.29 471.2750 48.24 - 57.73 2 2E5 51.70 128 136 N
R.IMNVIGEPIDER.G Y 2.26 2.51 693.3599 85.10 - 89.57 2 1.6E5 87.04 147 158 N
K.ILQDYK.S Y 2.00 5.48 390.2186 36.33 - 46.13 2 1.3E5 39.38 430 435 N
K.VLDTGAPIRIPVGPETLGR.I Y 2.32 30.43 654.3779 107.43 - 110.94 3 1.2E5 109.10 128 146 N
R.FLSQPFQVAEVFTGHMGK.L Y 2.47 46.04 675.0082 130.99 - 132.55 3 7.5E4 131.49 466 483 N
K.VVDLLAPYAK.G Y 2.27 11.51 544.8205 97.07 - 101.12 2 7.1E4 98.86 192 201 N
R.LVLEVAQHLGENTVR.T Y 2.20 9.74 559.9798 90.63 - 94.31 3 6.5E4 92.33 98 112 N
F.AHLDATTVLSR.A Y 1.90 5.49 592.3233 57.54 - 65.01 2 5.9E4 60.87 380 390 N
R.IMDPNIVGTEHY.E Y 2.26 0.67 694.8287 80.09 - 84.58 2 5.9E4 81.96 410 421 N
K.IGLFGGAGVGK.T Y 1.81 6.16 488.2850 85.56 - 90.81 2 5.8E4 87.79 205 215 N
K.VALVYGQMNEPPGAR.A Y 1.83 6.59 801.4047 74.11 - 79.57 2 5.7E4 76.43 268 282 N
R.FTQAGSEVSALLGR.I Y 1.44 7.07 718.3802 100.08 - 103.62 2 5.4E4 101.65 314 327 N
R.IMNVIGEPIDERGPISTK.H Y 2.03 19.69 657.0182 89.52 - 93.23 3 5E4 91.11 147 164 N
R.AIAELGIYPAVDPLDSTSR.I Y 2.34 7.93 663.3487 124.25 - 127.01 3 3.9E4 125.43 391 409 N
R.TIAMDGT(-18.01)EGLVR.G Y 1.34 3.21 622.8207 77.99 - 82.53 2 3.8E4 80.08 113 124 N Phospho neutral loss (ST)
Y.VAPAAAVTVAAGR.I Y 1.59 14.93 577.3386 51.36 - 59.62 2 3.6E4 54.61 53 65 N
R.IPSAVGYQPTLATDMGTMQER.I Y 0.67 5.10 756.0273 99.25 - 102.09 3 3.2E4 100.46 328 348 N
R.VALTGLSVAEYFR.D Y 1.89 18.00 713.3890 128.61 - 129.87 2 2.8E4 129.20 285 297 N
K.ILQDYK.S Y 2.24 15.63 779.4297 36.58 - 46.10 1 2.8E4 39.64 430 435 N
R.AIAELGIYPAVDPLDSTSR.I Y 2.19 6.73 994.5197 124.22 - 127.03 2 2.8E4 125.42 391 409 N
F.AHLDATTVLSR.A Y 0.83 0.29 395.2188 58.30 - 65.11 3 2.6E4 60.96 380 390 N
R.LVLEVAQHLGENTVR.T Y 2.13 11.83 839.4686 90.60 - 94.31 2 1.9E4 92.33 98 112 N
K.LVPLKETIK.G Y 1.31 15.54 347.5613 51.81 - 56.37 3 1.8E4 54.74 484 492 N
R.EGNDLYHEMIESGVINLK.D Y 1.32 0.33 687.6693 124.45 - 127.23 3 1.4E4 125.66 245 262 N
K.LVPLKETIK.G Y 1.25 23.34 520.8423 51.78 - 56.33 2 1.3E4 54.58 484 492 N
R.IPSAVGYQPTLATDMGTMQER.I Y 1.92 16.90 1133.5455 99.12 - 102.75 2 1.2E4 100.52 328 348 N
K.VALVYGQMNEPPGAR.A Y 0.18 2.95 534.6085 74.37 - 78.32 3 9.1E3 76.34 268 282 N
R.IPSAVGYQPTLATDMGTMQER.I Y 0.11 5.80 756.0179 98.69 - 101.09 3 8.6E3 99.71 328 348 N
R.FTQAGSEVSALLGR.I Y 0.84 1.96 479.2597 99.08 - 103.65 3 8.3E3 101.55 314 327 N
R.EGNDLYHEMIESGVINLKDDTSK.V Y 0.99 10.70 652.5639 117.77 - 119.13 4 7.9E3 118.52 245 267 N
R.FTQAGSEVSALLGR.I Y 0.19 0.24 718.3787 98.95 - 103.62 2 6.9E3 101.10 314 327 N
K.TVLIMELINNVAK.A Y 1.03 5.63 729.4222 135.14 - 136.10 2 4.9E3 135.79 216 228 N
R.T(+43.01)IAMDGTEGLVR.G Y 0.14 1.15 653.3299 94.08 - 96.91 2 4.7E3 95.36 113 124 N Carbamylation
R.IMNVIGEPIDER.G Y 0.46 0.39 462.5749 85.14 - 89.47 3 4.1E3 86.78 147 158 N
Y.M(+43.01)VGPIEEVVLK.A Y 0.72 0.34 628.8524 132.43 - 133.77 2 4E3 133.07 512 522 N Carbamylation
R.AIAELGIYPAVD(+21.98)PLDSTSR.I Y 0.45 0.66 670.6731 124.42 - 126.64 3 3.6E3 125.38 391 409 N Sodium adduct
K.VALVYGQMN(+.98)EPPGAR.A Y 0.08 5.51 534.9466 75.42 - 77.18 3 3.2E3 76.13 268 282 N Deamidation (NQ)
F.QVAEVFTGHMGK.L Y 0.03 1.44 435.2216 60.86 - 63.55 3 3E3 62.38 472 483 N
R.VALTGLSVAEYFR.D Y 0.72 7.47 475.9300 128.29 - 129.53 3 2.6E3 129.05 285 297 N
R.FLSQPFQVAEVFTGHMGK.L Y 0.69 5.21 1012.0104 131.12 - 131.92 2 2.6E3 131.43 466 483 N
R.IMNVIGEPIDERGPISTK.H Y 0.68 9.81 985.0281 89.62 - 91.64 2 2.5E3 90.42 147 164 N
K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A Y 0.19 5.81 961.4905 129.37 - 130.44 4 1.4E3 129.68 354 390 N
R.FTQAGSEVSALLGR.I Y 0.03 3.36 479.2553 100.88 - 103.40 3 1.2E3 102.58 314 327 N
K.VALVYGQMNEPPGAR.A Y 0.14 0.93 801.3975 73.98 - 78.88 2 1.2E3 75.54 268 282 N
K.VVDLLAPYAK.G Y 0.03 2.91 544.8160 98.23 - 99.61 2 734.7 98.89 192 201 N
R.EGNDLYHEMIESGVINLK.D Y 0.08 2.40 687.6716 124.74 - 127.14 3 724 125.55 245 262 N
K.TVLIMELINNVAK.A Y 0.90 3.53 486.6200 133.79 - 136.10 3 703.7 135.63 216 228 N
K.SLQDIIAILGMDELSEEDKLTVAR.A Y 0.60 0.92 887.1341 135.93 - 136.93 3 505.8 136.71 436 459 N
total 52 peptides