| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.AGFAGDDAPR.A 4.46 4.36 488.7315 37.19 - 47.02 2 3.6E6 39.77 21 30 N
K.EITALAPSTMK.I 3.41 2.34 581.3170 65.53 - 71.78 2 3.1E6 67.95 318 328 N
R.AVFPSIVGRPR.H 0.81 2.70 400.2406 75.91 - 81.36 3 2.3E6 78.36 31 41 N
K.DSYVGDEAQSK.R 3.58 2.16 599.7689 32.44 - 41.34 2 2.1E6 34.45 53 63 N
R.HQGVMVGMGQK.D 2.81 5.69 586.2929 39.62 - 49.34 2 1.9E6 42.08 42 52 N
K.YPIE(+14.02)HGIITNWDDMEK.I 2.39 2.23 658.9828 102.80 - 107.55 3 1.9E6 104.93 71 86 N Methylation (DE)
R.AVFPSIVGRPR.H 2.38 8.10 599.8596 74.70 - 81.75 2 1.7E6 77.46 31 41 N
R.VAPEEHPTLLTEAPLNPK.A 1.43 33.53 652.6957 83.00 - 86.36 3 1.5E6 84.60 98 115 N
R.HQGVMVGMGQK.D 2.24 4.61 391.1971 39.66 - 49.54 3 1.5E6 42.41 42 52 N
R.AVFPSIVGR.P 3.40 0.83 473.2818 86.71 - 90.91 2 1.4E6 88.71 31 39 N
K.IWHHTFYNELR.V 1.86 26.37 505.9262 64.98 - 72.67 3 9.7E5 67.86 87 97 N
R.VAPEEHPTLLTEAPLNPK.A 0.59 8.69 652.6829 83.48 - 88.22 3 8.8E5 85.85 98 115 N
R.GILTLK.Y 2.04 4.94 644.4383 67.33 - 74.10 1 7.9E5 69.85 65 70 N
K.SYELPDGQVITIGNER.F 1.28 9.05 895.9565 104.34 - 109.77 2 7.4E5 106.53 241 256 N
K.YPIEHGIITNWDDMEK.I 0.31 7.63 654.3061 96.31 - 100.36 3 7.4E5 97.98 71 86 N
K.IIAPPER.K 2.98 0.20 398.2416 40.44 - 49.34 2 7.3E5 42.76 331 337 N
K.SYELPDGQVITIGNER.F 3.27 0.16 597.6377 104.34 - 109.13 3 6.1E5 106.31 241 256 N
K.RGILTLK.Y 0.97 14.28 400.7776 54.00 - 57.53 2 5.6E5 55.50 64 70 N
R.H(+43.01)QGVMVGMGQK.D 2.34 3.02 607.7951 49.24 - 58.56 2 5.3E5 51.89 42 52 N Carbamylation
K.YPIEHGIITNWDDMEK.I 2.12 5.43 980.9636 95.65 - 100.96 2 3.5E5 97.73 71 86 N
R.DLTDYLMK.I 0.55 8.65 499.7446 101.20 - 105.35 2 3.4E5 102.75 186 193 N
K.DSYVGDEAQSKR.G 1.84 20.52 677.8186 30.78 - 36.05 2 2.9E5 32.30 53 64 N
R.GYSFVTTAER.E 2.35 2.03 565.7813 62.76 - 69.22 2 2.6E5 65.05 199 208 N
R.A(+43.01)VFPSIVGRPR.H 2.01 5.26 621.3625 98.99 - 103.11 2 2.6E5 100.99 31 41 N Carbamylation
L.TEAPLNPK.A 2.21 2.97 435.2416 33.80 - 42.14 2 2.5E5 35.75 108 115 N
R.DLTDYLMK.I 0.64 9.56 499.7544 100.94 - 104.38 2 2.5E5 102.31 186 193 N
K.DLYANNVLSGGTTMYPGIADR.M 0.79 2.39 743.3644 112.07 - 115.84 3 2.2E5 113.42 294 314 N
R.KDLYANNVLSGGTTMYPGIADR.M 2.24 7.88 786.0627 97.07 - 101.47 3 2.1E5 98.72 293 314 N
K.YPIE(+14.02)HGIITNWDDMEK.I 1.61 9.07 987.9732 102.90 - 107.74 2 2.1E5 104.82 71 86 N Methylation (DE)
K.AGFAGDDAPR.A 2.67 12.03 976.4521 37.19 - 46.93 1 2E5 39.74 21 30 N
K.IWHHTFYNELR.V 1.04 2.88 379.6940 66.69 - 72.41 4 1.9E5 68.64 87 97 N
K.DSYVGDEAQSK.R 2.44 4.97 1198.5260 32.44 - 41.44 1 1.8E5 34.44 53 63 N
R.VAPEEHPTLLTEAPLNPK.A 1.92 5.42 978.5294 83.00 - 87.98 2 1.7E5 85.23 98 115 N
K.DSYVGDEAQSKR.G 0.60 8.37 452.2211 30.81 - 33.81 3 1.6E5 31.69 53 64 N
K.ILTER.G 0.65 5.97 316.1913 32.45 - 38.22 2 1.5E5 33.75 194 198 N
K.IWHHTFYNELR.V 0.58 3.06 758.3846 65.05 - 72.36 2 1.4E5 68.08 87 97 N
R.G(+43.01)ILTLK.Y 2.34 4.41 687.4441 95.42 - 99.61 1 1.2E5 97.24 65 70 N Carbamylation
K.IKIIAPPER.K 2.28 4.88 346.2234 53.01 - 60.32 3 1.2E5 55.44 329 337 N
Y.ANNVLSGGTTMYPGIADR.M 1.68 0.27 918.9540 87.08 - 90.71 2 1.2E5 88.76 297 314 N
K.DLYANNVLSGGTTMYPGIADR.M 1.70 4.17 1114.5401 112.10 - 115.43 2 1.1E5 113.51 294 314 N
K.IIAPPERK.Y 2.36 12.71 308.5283 33.33 - 42.01 3 1.1E5 35.28 331 338 N
K.EITALAPSTMK.I 2.19 2.09 1161.6229 65.53 - 71.85 1 1E5 67.93 318 328 N
K.ILTER.G 1.98 0.60 631.3806 31.23 - 38.29 1 9.8E4 33.24 194 198 N
K.ILTER.G 0.39 7.32 316.1965 31.74 - 33.44 2 9.4E4 32.52 194 198 N
Y.ANNVLSGGTTMYPGIADR.M 1.08 0.51 612.9753 87.18 - 91.10 3 8.4E4 88.83 297 314 N
R.LDLAGR.D 1.20 0.08 644.3793 41.78 - 50.31 1 7.9E4 44.06 180 185 N
K.Q(-17.03)EYDEAGPSIVHR.K 1.46 4.42 742.3492 61.50 - 67.30 2 7.7E4 63.85 362 374 N Pyro-glu from Q
R.HQGVMVGMGQK.D 1.81 8.53 1171.5751 39.66 - 49.01 1 7.7E4 42.07 42 52 N
K.IKIIAPPERK.Y 2.28 11.44 388.9222 43.98 - 52.28 3 7.7E4 46.42 329 338 N
K.IKIIAPPER.K 2.32 5.68 518.8322 53.01 - 60.32 2 7.4E4 55.43 329 337 N
F.YNELR.V 1.41 1.30 347.6811 31.23 - 37.51 2 7.2E4 32.85 93 97 N
K.Q(-17.03)EYDEAGPSIVHRK.C 1.48 9.23 537.9336 50.23 - 58.46 3 7.1E4 53.18 362 375 N Pyro-glu from Q
K.CDIDIR.K 0.93 6.28 367.6827 48.27 - 56.49 2 6.7E4 51.19 287 292 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 1.74 5.69 668.6483 124.90 - 127.94 3 6.4E4 126.55 71 86 N Carbamylation
K.QEYDEAGPSIVHR.K 1.87 2.15 500.9095 47.62 - 56.03 3 6.1E4 50.36 362 374 N
R.DLTDYLMK.I 1.67 1.13 998.4880 100.99 - 105.38 1 5.9E4 102.54 186 193 N
R.HQGVM(+15.99)VGMGQK.D 1.78 10.41 594.2885 33.33 - 41.64 2 5.2E4 35.37 42 52 N Oxidation (M)
H.GIITNWDDMEK.I 1.52 0.56 661.3144 94.98 - 98.75 2 4.7E4 96.54 76 86 N
K.A(+43.01)GFAGDDAPR.A 0.60 1.80 510.2373 50.19 - 54.01 2 4.6E4 52.30 21 30 N Carbamylation
K.DSYVGDEAQSKR.G 0.03 0.87 452.2142 31.65 - 38.64 3 4.6E4 34.20 53 64 N
K.IIAPPERK.Y 0.80 11.47 462.2944 33.33 - 36.07 2 4.5E4 34.37 331 338 N
K.D(+43.01)SYVGDEAQSK.R 1.72 2.17 621.2716 40.68 - 49.90 2 4.3E4 42.97 53 63 N Carbamylation
K.I(+43.01)WHHTFYNELR.V 0.90 10.64 520.2658 105.64 - 108.71 3 3.6E4 107.08 87 97 N Carbamylation
K.Y(+43.01)PIEHGIITNWDDMEK.I 1.53 1.40 1002.4675 124.78 - 128.22 2 3.5E4 126.61 71 86 N Carbamylation
R.LDLAGR.D 1.02 0.36 644.3771 40.27 - 48.18 1 3.2E4 42.61 180 185 N
R.G(+43.01)ILTLK.Y 1.46 1.86 344.2256 95.39 - 99.17 2 3.2E4 97.28 65 70 N Carbamylation
K.C(+57.02)DIDIR.K 0.60 2.11 396.1953 43.70 - 51.78 2 3.1E4 46.33 287 292 N Carbamidomethylation
V.FPSIVGRPR.H 0.35 7.10 343.5366 75.94 - 81.39 3 3.1E4 78.38 33 41 N
R.V(+43.01)APEEHPTLLTEAPLNPK.A 1.46 1.75 667.0253 101.30 - 104.58 3 3.1E4 102.98 98 115 N Carbamylation
K.CDIDIRK.D 0.67 6.26 431.7317 37.11 - 42.97 2 3.1E4 39.25 287 293 N
K.IWHHTFYNELR.V 0.09 5.28 758.3685 64.73 - 68.73 2 3.1E4 66.02 87 97 N
R.MQKEITALAPSTMK.I 1.31 15.06 516.9449 64.71 - 68.49 3 3.1E4 66.89 315 328 N
K.DLYANNVLSGGTTMYPGIADR.M 0.04 1.69 743.3515 113.13 - 118.40 3 2.9E4 115.27 294 314 N
K.D(+43.01)SYVGDEAQSKR.G 0.46 4.02 699.3306 35.69 - 44.74 2 2.8E4 38.56 53 64 N Carbamylation
K.DSYVGDEAQS(-18.01)K.R 1.59 7.92 590.7649 33.66 - 42.54 2 2.8E4 35.93 53 63 N Phospho neutral loss (ST)
F.QQMWISK.Q 0.72 3.31 460.7388 56.11 - 62.81 2 2.7E4 57.88 355 361 N
R.HQGVM(+15.99)VGMGQK.D 0.71 2.13 396.5295 33.49 - 42.04 3 2.7E4 35.42 42 52 N Oxidation (M)
K.QEYDEAGPSIVHRK.C 0.57 1.07 543.6099 40.65 - 44.32 3 2.6E4 42.49 362 375 N
K.IIAPPERK.Y 0.65 2.60 462.2857 31.95 - 41.71 2 2.5E4 35.43 331 338 N
K.IKIIAPPERK.Y 1.92 18.94 582.8798 44.01 - 52.35 2 2.4E4 46.42 329 338 N
Y.ALPHAIMR.L 0.31 7.02 303.5133 47.35 - 50.95 3 2.4E4 48.79 172 179 N
K.E(-18.01)ITALAPSTMK.I 0.73 4.20 572.3140 93.03 - 96.80 2 2.3E4 94.96 318 328 N Pyro-glu from E
K.C(+42.01)DIDIR.K 0.94 0.53 388.6918 53.76 - 61.18 2 2.2E4 56.14 287 292 N Acetylation (Protein N-term)
K.A(+42.01)GFAGDDAPR.A 0.08 5.54 509.7307 51.16 - 53.12 2 2.1E4 52.05 21 30 N Acetylation (Protein N-term)
D.GQVITIGNER.F 0.87 5.01 543.8035 52.52 - 56.20 2 2.1E4 54.39 247 256 N
K.I(+43.01)WHHTFYNELR.V 0.27 0.28 520.2568 106.92 - 111.13 3 2E4 108.59 87 97 N Carbamylation
R.KDLYANNVLSGGTTMYPGIADR.M 1.63 8.26 1178.5914 96.76 - 100.53 2 1.9E4 98.69 293 314 N
R.GILTLKYPIEHGIITNWDDMEK.I 0.53 6.18 647.3409 125.21 - 128.50 4 1.8E4 126.82 65 86 N
K.QEYDEAGPSIVHRK.C 0.30 0.46 407.9586 41.30 - 44.22 4 1.6E4 43.15 362 375 N
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.97 2.62 866.1691 129.58 - 130.82 4 1.5E4 129.97 257 286 N Carbamidomethylation
K.EITALAPSTMK.I 0.36 1.06 581.3056 67.27 - 75.08 2 1.5E4 70.94 318 328 N
R.AVFPSIVGRPR.H 0.13 3.50 400.2441 78.90 - 83.75 3 1.4E4 80.73 31 41 N
R.LDLAGRDLTDYLMK.I 1.66 2.80 541.9555 117.51 - 120.61 3 1.4E4 118.97 180 193 N
K.EITALAPSTMK.I 0.13 5.91 581.3179 67.57 - 71.05 2 1.4E4 68.71 318 328 N
R.A(+43.01)VFPSIVGRPR.H 1.43 6.36 414.5783 99.06 - 102.81 3 1.4E4 100.98 31 41 N Carbamylation
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.54 4.04 1038.4954 132.39 - 134.77 3 1.4E4 133.29 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.E(+43.01)ITALAPSTMK.I 1.41 3.90 1204.6321 96.12 - 99.28 1 1.3E4 97.67 318 328 N Carbamylation
K.IWHHTFYNELR.V 0.17 3.57 758.3711 67.16 - 75.24 2 1.3E4 71.01 87 97 N
Y.ELPDGQVITIGNER.F 0.65 3.57 770.9036 82.76 - 87.20 2 1.3E4 84.69 243 256 N
Y.SFVTTAER.E 0.35 5.68 455.7342 43.29 - 50.87 2 1.3E4 45.53 201 208 N
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.07 0.27 1053.4984 129.37 - 131.92 3 1.2E4 130.96 259 286 N Carbamidomethylation
K.YPIE(+14.02)HGIIT(-18.01)NWDDMEK.I 0.22 2.44 652.9740 106.24 - 109.86 3 1.2E4 107.93 71 86 N Methylation (DE); Phospho neutral loss (ST)
R.MQKEITALAPSTMK.I 0.88 9.74 774.9133 64.71 - 67.97 2 1E4 66.68 315 328 N
R.V(+43.01)APEEHPTLLTEAPLNPK.A 1.01 1.35 1000.0257 101.50 - 104.49 2 9.9E3 103.03 98 115 N Carbamylation
S.KQEYDEAGPSIVHR.K 0.15 1.14 543.6085 43.08 - 45.89 3 9.8E3 44.56 361 374 N
K.QEYDEAGPSIVHRK.C 0.75 2.59 814.9092 40.37 - 44.12 2 9.3E3 42.37 362 375 N
C.D(+42.01)DDETTALVCDNGSGLVK.A Y 0.73 2.43 947.4309 96.60 - 101.15 2 9.2E3 98.18 3 20 Y Acetylation (Protein N-term)
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 1.04 1.03 779.1162 132.39 - 133.03 4 8.5E3 132.63 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.S(+43.01)YELPDGQVITIGNER.F 0.45 0.46 917.4551 118.78 - 123.41 2 8.4E3 121.09 241 256 N Carbamylation
R.GILTLKYPIE(+14.02)HGIITNWDDMEK.I 1.19 22.41 650.8478 128.42 - 129.43 4 8.4E3 128.86 65 86 N Methylation (DE)
R.G(+43.01)YSFVTTAER.E 0.45 1.30 587.2961 84.31 - 88.66 2 8.3E3 86.52 199 208 N Carbamylation
K.I(+43.01)WHHTFYNELR.V 0.48 5.31 779.8825 105.88 - 111.05 2 8.1E3 107.89 87 97 N Carbamylation
K.S(+43.01)YELPDGQVITIGNER.F 0.63 0.06 917.4330 120.70 - 126.42 2 7.9E3 123.24 241 256 N Carbamylation
K.S(+43.01)YELPDGQVITIGNER.F 0.54 0.49 611.9720 118.92 - 122.31 3 7.2E3 121.00 241 256 N Carbamylation
R.GILTLKYPIEHGIITNWDDMEK.I 1.02 7.93 862.7836 125.34 - 127.43 3 6.9E3 126.58 65 86 N
R.M(+43.01)QKEITALAPSTMK.I 0.55 3.77 796.4164 84.19 - 86.63 2 6.6E3 85.28 315 328 N Carbamylation
R.F(+43.01)RCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.31 1.81 862.6664 129.90 - 131.59 4 6.3E3 130.28 257 286 N Carbamylation
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.61 0.37 1048.8228 130.82 - 131.97 3 6.2E3 131.28 259 286 N Carbamylation
Y.VALDFENEMATAASSSSLEK.S 0.58 0.18 1050.4947 112.42 - 114.90 2 5.9E3 113.53 221 240 N
R.MQK(+43.01)EITALAPSTMK.I 0.17 5.86 531.2745 83.30 - 86.20 3 5.9E3 84.84 315 328 N Carbamylation
L.SGGTTMYPGIADR.M 0.06 5.12 663.3253 59.16 - 61.60 2 5.6E3 60.15 302 314 N
K.S(-18.01)YE(+14.02)LPDGQVITIGNER.F 0.22 3.03 596.3110 105.04 - 108.84 3 5E3 106.79 241 256 N Phospho neutral loss (ST); Methylation (DE)
K.LCYVALDFENEMATAASSSSLEK.S 0.17 1.03 827.0523 130.85 - 135.36 3 4.8E3 133.30 218 240 N
K.DLYANNVLS(-18.01)GGTTMYPGIADR.M 0.06 5.20 737.3628 115.20 - 116.68 3 4.7E3 115.96 294 314 N Phospho neutral loss (ST)
K.IK(+43.01)IIAPPER.K 0.92 1.63 360.5600 53.04 - 60.32 3 3.9E3 55.45 329 337 N Carbamylation
Y.ANNVLSGGTTMYPGIADR.M 0.23 0.88 918.9326 85.62 - 90.28 2 3.5E3 87.87 297 314 N
R.LDLAGRDLTDYLMK.I 0.39 1.44 812.4264 117.64 - 119.44 2 3.4E3 118.60 180 193 N
K.D(+42.01)LYANNVLSGGTTMYPGIADR.M 0.17 5.99 568.2642 115.47 - 117.13 4 3.2E3 116.26 294 314 N Acetylation (Protein N-term)
R.G(+43.01)ILTLK.Y 0.36 1.31 344.2252 93.31 - 99.17 2 3E3 95.36 65 70 N Carbamylation
R.AVFPSIVGRPR.H 0.11 1.03 599.8541 74.02 - 78.22 2 2.9E3 74.64 31 41 N
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.40 1.79 1135.5463 130.87 - 133.44 3 2.9E3 131.47 257 286 N
R.HQGVMVGMGQK(+43.01)DSYVGDEAQSK.R 0.09 1.90 798.7088 68.00 - 69.52 3 2.8E3 68.45 42 63 N Carbamylation
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 0.08 1.74 1034.4839 130.99 - 132.26 3 2.7E3 131.66 259 286 N
K.IWHHTFYNELR.V 0.04 0.89 379.6936 69.97 - 78.73 4 2E3 72.24 87 97 N
L.ASLSTFQQMWISK.Q 0.09 3.14 763.8802 121.57 - 123.50 2 1.8E3 122.46 349 361 N
R.D(+43.01)LTDYLMK.I 0.58 2.04 521.2539 117.47 - 118.76 2 1.7E3 118.07 186 193 N Carbamylation
K.QEYDEAGPSIVHRK.C 0.05 0.02 814.9040 43.60 - 45.22 2 1.5E3 44.45 362 375 N
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.03 4.29 851.9207 130.76 - 131.91 4 1.3E3 131.29 257 286 N
K.SYELPDGQVITIGNER.F 0.02 5.35 895.9432 103.60 - 107.39 2 972.8 105.08 241 256 N
K.DLYANNVLSGGTTMYPGIADR.M 0.04 0.78 1114.5346 114.31 - 116.73 2 407.3 115.53 294 314 N
total 140 peptides