| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.LSGPVFNVVK.Y Y 2.73 4.74 530.3156 87.32 - 91.32 2 8.6E5 89.27 114 123 Y
K.ILAGSSADMNINGPK.I Y 1.44 3.83 744.3841 63.68 - 70.87 2 5.5E5 65.95 45 59 Y
K.LAVCVGQSNK.A Y 1.41 5.16 509.7744 44.87 - 54.10 2 2.9E5 47.14 91 100 Y
W.SSTPGLTGVTAPQIK.I Y 2.49 0.10 728.9069 74.88 - 79.57 2 2.1E5 77.01 30 44 N
K.ALVVVVGSGLGSK.L Y 1.30 5.88 593.3634 83.92 - 90.37 2 1.9E5 86.32 101 113 N
K.ALVVVVGSGLGSK.L Y 0.30 6.83 593.3676 84.54 - 88.90 2 1.6E5 86.09 101 113 N
K.LAVC(+57.02)VGQSNK.A Y 1.23 7.75 538.2877 43.18 - 51.07 2 1.2E5 45.29 91 100 N Carbamidomethylation
M.S(+42.01)WDAYR.D Y 1.44 4.86 839.3736 71.36 - 76.98 1 1.1E5 73.48 2 7 N Acetylation (Protein N-term)
K.L(+43.01)AVCVGQSNK.A Y 0.31 7.02 531.2847 43.53 - 47.44 2 6.1E4 44.84 91 100 N Carbamylation
M.S(+42.01)WDAYR.D Y 0.87 2.04 420.1876 71.77 - 77.16 2 5.2E4 73.71 2 7 N Acetylation (Protein N-term)
K.ILAGSSADMNINGPK.I Y 0.74 0.14 496.5902 64.09 - 70.69 3 3.8E4 66.32 45 59 N
M.S(+42.01)WDAYR.D Y 0.18 6.18 420.1949 71.39 - 75.35 2 3.4E4 73.03 2 7 N Acetylation (Protein N-term)
K.C(+57.02)MLLR.D Y 1.64 3.41 346.6840 52.24 - 60.22 2 2.9E4 55.05 65 69 N Carbamidomethylation
K.LSGPVFNVVK.Y Y 1.81 7.56 1059.6244 87.39 - 91.29 1 2.6E4 89.26 114 123 N
R.QDTQSFC(+57.02)MHLK.T Y 1.99 39.98 465.5518 59.86 - 63.94 3 2.1E4 61.59 73 83 N Carbamidomethylation
W.SSTPGLTGVTAPQIK.I Y 0.54 1.23 486.2735 75.66 - 79.76 3 2.1E4 77.57 30 44 N
K.ALVVVVGSGLGSK.L Y 0.32 2.45 593.3673 88.96 - 96.04 2 2.1E4 90.23 101 113 N
K.LAVCVGQSNK.A Y 0.07 4.20 509.7741 44.48 - 48.31 2 2E4 46.22 91 100 N
R.QDTQSFCMHLK.T Y 1.75 49.11 446.5422 65.49 - 70.09 3 1.9E4 67.30 73 83 N
K.L(+43.01)SGPVFNVVK.Y Y 1.39 4.21 551.8188 118.17 - 121.43 2 1.7E4 119.61 114 123 N Carbamylation
R.QDTQSFCMHLK.T Y 0.55 1.07 669.3078 63.75 - 70.44 2 1.7E4 65.88 73 83 N
F.GLDGSTWSSTPGLTGVTAPQIK.I Y 1.46 0.22 1087.0609 105.64 - 109.26 2 1.2E4 107.43 23 44 N
R.QDTQSFCMHLK(+43.01).T Y 0.65 7.03 460.8781 60.13 - 64.45 3 1E4 62.41 73 83 N Carbamylation
R.QDTQSFC(+57.02)MHLK.T Y 0.35 4.53 697.8287 60.55 - 66.35 2 9.3E3 62.76 73 83 N Carbamidomethylation
K.C(+43.01)MLLR.D Y 0.22 6.26 339.6785 54.07 - 57.60 2 4.3E3 55.74 65 69 N Carbamylation
R.QDTQSFCMHLK.T Y 0.08 5.44 669.3154 65.55 - 67.96 2 4.1E3 67.09 73 83 N
R.DQLTAVESVTEAGIFGLDGSTWSSTPGLTGVTAPQIK.I Y 0.53 0.62 934.2252 135.06 - 135.86 4 1.8E3 135.36 8 44 N
total 27 peptides