| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
R.ALDTMNFDVIK.G 1.72 4.27 633.8253 105.21 - 109.51 2 8E4 107.63 68 78 N
R.GFGFVSFER.H 1.95 10.58 523.2618 107.02 - 111.53 2 6.3E4 109.17 232 240 N
R.YQGVNLYVK.N 1.34 5.76 542.2983 69.05 - 74.42 2 5.3E4 71.39 291 299 N
K.SGVGNIFIK.N 0.49 7.01 467.7790 81.86 - 87.19 2 4.3E4 84.04 96 104 N
F.SAFGNILSCK.V 1.09 1.87 520.2717 93.51 - 101.54 2 3.8E4 95.78 120 129 N
K.SGVGNIFIK.N 0.62 2.42 467.7682 80.82 - 86.76 2 3.7E4 84.04 96 104 N
R.IVATKPLYVALAQR.K 0.45 7.25 514.9924 86.06 - 88.06 3 3.5E4 87.19 357 370 N
R.SKVDEAVAVLQAHQAK.E 1.38 7.51 565.3154 66.79 - 72.09 3 3.3E4 68.99 608 623 N
R.LFPLIQNMHPSLTGK.I 1.33 6.25 565.9811 117.13 - 121.62 3 3.1E4 119.48 569 583 N
R.IMWSQR.D 1.19 6.07 410.7131 50.98 - 59.13 2 3E4 53.55 84 89 N
R.IVATKPLYVALAQR.K 0.58 2.42 514.9831 86.02 - 89.90 3 2.7E4 88.36 357 370 N
K.GFGFVCFSSPEEATK.A 0.99 4.20 803.3709 119.76 - 123.26 2 2.1E4 121.32 334 348 N
R.Q(-17.03)AHLTNQYMQR.M 0.76 3.07 686.8286 52.76 - 56.38 2 1.9E4 54.65 375 385 N Pyro-glu from Q
K.EFTPFGTITSAK.V 1.07 2.53 649.8383 98.38 - 102.32 2 1.7E4 100.05 313 324 N
K.NFGEDMDEEK.L 1.32 7.04 607.2439 45.99 - 49.98 2 1.7E4 48.16 197 206 N
K.EFTNVYVK.N 1.01 2.06 500.2636 59.19 - 65.85 2 1.6E4 61.43 189 196 N
K.VVCDENGSK.G 0.39 1.61 475.7207 27.49 - 30.26 2 1.5E4 28.83 130 138 N
R.IVATKPLYVALAQR.K 1.51 7.49 771.9741 86.06 - 89.87 2 1.5E4 87.88 357 370 N
P.EEATK.A 0.58 3.36 577.2778 29.52 - 34.11 1 1.4E4 30.87 344 348 N
R.SLGYAYVNFQQPADAER.A 1.51 5.68 964.9647 92.94 - 96.80 2 1.4E4 94.78 51 67 N
R.DMITR.R 0.35 0.74 318.1653 33.06 - 39.64 2 1.3E4 35.37 45 49 N
Y.VGDLHQDVTEAMLYEK.F 1.31 3.78 616.6362 88.71 - 92.55 3 1.3E4 90.33 15 30 N
R.QAHLTNQYMQR.M 1.30 4.16 695.3414 39.59 - 48.51 2 1.2E4 41.96 375 385 N
K.YGNAMSIR.V 0.27 6.99 456.2288 44.44 - 48.33 2 1.2E4 45.94 214 221 N
R.KFEQMK.Q 0.22 1.08 405.7145 29.76 - 31.51 2 1.2E4 30.62 279 284 N
R.EAELGAR.A 0.02 1.26 373.1957 30.85 - 33.10 2 1.1E4 31.69 180 186 N
R.SLGYAYVNFQQPADAER.A 0.43 0.83 643.6448 93.48 - 96.50 3 1E4 94.79 51 67 N
F.MAAIPQAQNR.A 0.21 6.37 550.2942 40.99 - 44.21 2 9.6E3 42.44 410 419 N
K.FSPAGAILSIR.V 1.12 3.95 566.3314 111.41 - 115.20 2 9.6E3 113.44 31 41 N
K.GFGFVC(+57.02)FSSPEEATK.A 0.52 7.63 831.8877 111.51 - 114.08 2 8.5E3 113.03 334 348 N Carbamidomethylation
R.KEFTPFGTITSAK.V 0.73 5.41 476.2623 82.46 - 87.11 3 7.8E3 84.37 312 324 N
K.GFGFVCFSSPEEATK(+43.01).A 0.48 4.74 824.8730 115.65 - 117.94 2 6.3E3 117.07 334 348 N Carbamylation
R.SKVDEAVAVLQAHQAK.E 0.18 6.09 424.2408 66.41 - 69.75 4 5.8E3 68.52 608 623 N
K.MNGMLLNDRK.V 0.16 6.22 397.8770 50.09 - 53.76 3 4.4E3 52.03 158 167 N
K.YAAGVR.N 0.06 0.56 318.6807 29.60 - 33.51 2 3.8E3 31.38 517 522 N
F.SAFGNILSCK(+43.01).V 0.15 4.64 541.7750 86.78 - 89.18 2 3.1E3 88.12 120 129 N Carbamylation
R.SKVDEAVAVLQAHQAK.E 0.02 4.35 565.3123 65.69 - 72.09 3 3E3 69.01 608 623 N
R.NPQQHMPAQPVPMQQPAVHVQGQEPLTASMLAAAPPQEQK.Q Y 0.87 12.70 1078.3036 98.75 - 101.02 4 2.7E3 100.12 523 562 Y
K.ALYDTFSAFGNILSCK.V 0.35 6.30 875.4344 134.05 - 136.36 2 2.1E3 134.77 114 129 N
K.GFGFVCFSSPEEATK.A 0.05 5.34 803.3688 118.32 - 122.31 2 1.3E3 120.56 334 348 N
total 40 peptides