| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.AGFAGDDAPR.A 4.26 6.80 488.7308 36.73 - 47.02 2 3.9E6 40.55 21 30 N
R.AVFPSIVGRPR.H 2.04 2.61 400.2405 75.91 - 81.36 3 3.9E6 78.03 31 41 N
K.EITALAPSTMK.I 3.80 6.88 581.3160 65.98 - 71.78 2 3.8E6 68.29 318 328 N
R.VAPEEHPTLLTEAPLNPK.A 3.15 8.26 652.6884 83.45 - 88.22 3 2.7E6 85.42 98 115 N
K.DSYVGDEAQSK.R 3.24 6.47 599.7681 32.77 - 41.34 2 2.6E6 35.19 53 63 N
R.HQGVMVGMGQK.D 3.13 8.90 586.2911 38.60 - 49.34 2 2.2E6 42.83 42 52 N
K.YPIE(+14.02)HGIITNWDDMEK.I 2.12 1.38 658.9807 103.46 - 107.55 3 1.8E6 105.26 71 86 N Methylation (DE)
R.HQGVMVGMGQK.D 3.34 6.30 391.1967 38.64 - 49.54 3 1.7E6 42.84 42 52 N
K.IIAPPER.K 3.32 18.79 398.2411 39.05 - 49.34 2 1.6E6 43.41 331 337 N
R.AVFPSIVGRPR.H 2.53 14.01 599.8585 75.94 - 81.75 2 1.6E6 77.83 31 41 N
R.DLTDYLMK.I 2.91 22.15 499.7474 101.20 - 105.35 2 1.5E6 102.57 186 193 N
R.AVFPSIVGR.P 1.84 1.19 473.2783 86.90 - 90.91 2 1.5E6 89.21 31 39 N
K.SYELPDGQVITIGNER.F 1.30 20.63 895.9476 102.80 - 109.77 2 1.5E6 106.23 241 256 N
R.GILTLK.Y 2.10 13.59 644.4371 68.13 - 74.10 1 9.8E5 70.24 65 70 N
K.YPIEHGIITNWDDMEK.I 0.17 6.19 654.3068 96.31 - 100.93 3 6.9E5 98.58 71 86 N
K.ILTER.G 2.16 21.28 316.1930 32.42 - 38.22 2 6.6E5 33.77 194 198 N
V.FPSIVGRPR.H 2.21 4.52 514.8056 75.88 - 81.72 2 6.4E5 77.83 33 41 N
K.IWHHTFYNELR.V 1.62 12.04 505.9227 66.45 - 72.97 3 6.4E5 68.90 87 97 N
R.H(+43.01)QGVMVGMGQK.D 2.44 6.61 607.7948 48.82 - 58.56 2 6.4E5 52.53 42 52 N Carbamylation
R.GYSFVTTAER.E 2.37 13.96 565.7802 62.52 - 69.22 2 5.9E5 65.34 199 208 N
K.YPIEHGIITNWDDMEK.I 2.23 9.34 980.9611 96.24 - 100.96 2 4.4E5 97.85 71 86 N
K.SYELPDGQVITIGNER.F 0.86 1.94 597.6328 104.97 - 109.13 3 4.4E5 106.71 241 256 N
L.TEAPLNPK.A 2.22 1.09 435.2411 33.60 - 42.14 2 3.4E5 36.37 108 115 N
R.KDLYANNVLSGGTTMYPGIADR.M 2.35 13.12 786.0609 97.29 - 101.47 3 3E5 98.83 293 314 N
R.A(+43.01)VFPSIVGRPR.H 2.01 14.49 621.3610 99.68 - 103.11 2 2.8E5 101.12 31 41 N Carbamylation
K.DLYANNVLSGGTTMYPGIADR.M 0.75 3.98 743.3604 113.10 - 116.15 3 2.7E5 113.94 294 314 N
K.YPIE(+14.02)HGIITNWDDMEK.I 1.56 9.77 987.9713 103.66 - 107.74 2 2.3E5 105.06 71 86 N Methylation (DE)
R.LDLAGR.D 1.37 11.10 644.3789 40.29 - 50.31 1 2.2E5 44.70 180 185 N
K.IWHHTFYNELR.V 1.22 10.76 379.6934 66.69 - 73.37 4 2.2E5 68.82 87 97 N
K.DSYVGDEAQSK.R 2.24 8.35 1198.5249 32.77 - 41.44 1 2E5 35.16 53 63 N
R.VAPEEHPTLLTEAPLNPK.A 2.06 12.31 978.5274 83.45 - 87.98 2 2E5 85.41 98 115 N
K.AGFAGDDAPR.A 2.60 19.45 976.4510 36.76 - 46.93 1 1.9E5 40.53 21 30 N
K.IKIIAPPER.K 2.28 19.12 346.2227 52.91 - 60.32 3 1.9E5 55.97 329 337 N
K.QEYDEAGPSIVHR.K 2.10 32.77 500.9088 46.89 - 56.03 3 1.9E5 50.98 362 374 N
K.DSYVGDEAQSKR.G 1.33 4.01 677.8173 31.29 - 36.86 2 1.8E5 33.00 53 64 N
Y.ANNVLSGGTTMYPGIADR.M 1.73 4.15 918.9531 87.08 - 90.71 2 1.8E5 88.77 297 314 N
R.G(+43.01)ILTLK.Y 2.25 13.17 687.4423 95.78 - 99.61 1 1.8E5 97.33 65 70 N Carbamylation
R.DLTDYLMK.I 1.84 10.90 998.4854 101.34 - 105.38 1 1.8E5 102.56 186 193 N
K.IIAPPERK.Y 2.29 30.36 308.5276 33.29 - 42.01 3 1.7E5 35.92 331 338 N
K.IWHHTFYNELR.V 0.61 4.21 758.3829 66.42 - 72.50 2 1.7E5 68.59 87 97 N
K.Q(-17.03)EYDEAGPSIVHR.K 1.56 15.91 742.3482 60.90 - 67.30 2 1.6E5 64.12 362 374 N Pyro-glu from Q
Y.ANNVLSGGTTMYPGIADR.M 1.50 4.20 612.9719 87.18 - 90.78 3 1.4E5 88.73 297 314 N
R.AVFPSIVGRPR.H 0.02 5.31 400.2377 78.26 - 83.24 3 1.4E5 79.60 31 41 N
K.EITALAPSTMK.I 2.25 9.25 1161.6208 66.01 - 71.85 1 1.3E5 68.29 318 328 N
K.DLYANNVLSGGTTMYPGIADR.M 1.76 5.09 1114.5385 112.43 - 115.80 2 1.3E5 113.67 294 314 N
F.YNELR.V 1.59 3.55 347.6802 31.82 - 37.51 2 1.2E5 33.40 93 97 N
K.IKIIAPPER.K 2.26 19.14 518.8313 52.91 - 60.32 2 1.2E5 55.97 329 337 N
F.QQMWISK.Q 1.40 11.03 460.7382 54.85 - 62.81 2 1.1E5 58.03 355 361 N
K.Y(+43.01)PIEHGIITNWDDMEK.I 2.04 14.39 668.6459 125.37 - 127.94 3 1E5 126.80 71 86 N Carbamylation
K.IIAPPERK.Y 2.00 37.51 462.2890 33.32 - 41.71 2 9.9E4 35.93 331 338 N
V.FPSIVGRPR.H 1.66 2.97 343.5388 75.94 - 81.39 3 8.4E4 77.84 33 41 N
K.DSYVGDEAQSKR.G 0.29 3.08 452.2178 31.65 - 38.64 3 8.4E4 33.94 53 64 N
R.HQGVMVGMGQK.D 1.80 11.69 1171.5733 38.67 - 49.01 1 8.2E4 42.81 42 52 N
K.IKIIAPPERK.Y 2.18 16.66 388.9211 42.50 - 52.28 3 8.1E4 47.07 329 338 N
K.CDIDIR.K 0.85 4.15 367.6801 47.34 - 56.49 2 7.1E4 51.77 287 292 N
K.Q(-17.03)EYDEAGPSIVHRK.C 1.50 5.38 537.9321 49.84 - 58.46 3 6.6E4 53.75 362 375 N Pyro-glu from Q
K.C(+57.02)DIDIR.K 1.20 6.83 396.1921 42.53 - 51.78 2 6.5E4 46.80 287 292 N Carbamidomethylation
K.SYELPD(+21.98)GQVITIGNER.F 0.77 2.90 604.9663 104.75 - 107.58 3 6E4 106.31 241 256 N Sodium adduct
K.QEYDEAGPSIVHRK.C 0.86 5.92 543.6093 38.67 - 46.12 3 6E4 43.34 362 375 N
K.D(+43.01)SYVGDEAQSK.R 1.69 5.79 621.2706 39.12 - 49.90 2 6E4 43.69 53 63 N Carbamylation
K.I(+43.01)WHHTFYNELR.V 1.03 5.50 520.2603 106.74 - 111.13 3 5.6E4 108.19 87 97 N Carbamylation
H.GIITNWDDMEK.I 1.63 1.80 661.3132 95.41 - 98.75 2 5.6E4 96.65 76 86 N
K.Y(+43.01)PIE(+14.02)HGIITNWDDMEK.I 1.83 12.99 673.3176 129.41 - 130.63 3 5.5E4 130.12 71 86 N Carbamylation; Methylation (DE)
K.A(+43.01)GFAGDDAPR.A 0.48 2.11 510.2359 49.30 - 55.35 2 5.4E4 52.65 21 30 N Carbamylation
K.Y(+43.01)PIEHGIITNWDDMEK.I 1.70 6.43 1002.4648 125.00 - 128.22 2 5.4E4 126.84 71 86 N Carbamylation
K.IIAPPER.K 1.81 23.24 795.4745 39.02 - 49.20 1 5.2E4 43.41 331 337 N
R.G(+43.01)ILTLK.Y 1.69 8.70 344.2239 95.78 - 99.17 2 4.7E4 97.33 65 70 N Carbamylation
K.QEYDEAGPSIVHRK.C 0.95 7.20 407.9590 38.44 - 46.36 4 4.2E4 43.34 362 375 N
Y.SFVTTAER.E 1.47 5.37 455.7374 40.95 - 50.87 2 4.1E4 45.47 201 208 N
K.DLYANNVLSGGTTMYPGIADR.M 0.09 5.38 743.3642 113.12 - 118.21 3 4E4 116.53 294 314 N
R.V(+43.01)APEEHPTLLTEAPLNPK.A 1.54 5.71 667.0238 101.40 - 104.58 3 3.8E4 103.05 98 115 N Carbamylation
R.HQGVM(+15.99)VGMGQK.D 1.40 2.02 594.2865 33.99 - 41.64 2 3.6E4 36.25 42 52 N Oxidation (M)
K.YPIE(+14.02)HGIITNWDDMEK.I 0.06 4.55 987.9674 103.29 - 108.95 2 3.6E4 105.69 71 86 N Methylation (DE)
R.LDLAGR.D 0.38 3.76 322.6856 41.87 - 48.48 2 3.4E4 43.63 180 185 N
R.HQGVMVGMGQK.D 0.03 2.52 586.2958 43.96 - 47.64 2 3.4E4 45.45 42 52 N
K.C(+42.01)DIDIR.K 1.12 3.51 388.6913 53.76 - 61.18 2 3.2E4 56.87 287 292 N Acetylation (Protein N-term)
K.EITALAPSTMK.I 0.38 3.54 581.3093 69.13 - 75.08 2 3.2E4 71.48 318 328 N
K.IWHHTFYNELR.V 0.29 0.07 758.3709 69.27 - 77.64 2 3.1E4 72.13 87 97 N
S.KQEYDEAGPSIVHR.K 0.55 2.68 543.6089 43.08 - 48.02 3 2.7E4 45.68 361 374 N
K.IKIIAPPERK.Y 1.84 6.86 582.8789 42.47 - 52.35 2 2.7E4 47.07 329 338 N
R.LDLAGRDLTDYLMK.I 1.70 10.56 541.9540 117.87 - 120.61 3 2.5E4 119.15 180 193 N
L.SGGTTMYPGIADR.M 0.31 3.66 663.3148 58.85 - 63.19 2 2.3E4 61.41 302 314 N
R.KDLYANNVLSGGTTMYPGIADR.M 1.53 16.81 1178.5902 97.28 - 100.53 2 2.3E4 98.83 293 314 N
K.S(+43.01)YELPDGQVITIGNER.F 0.64 3.03 917.4507 118.78 - 123.41 2 2.3E4 121.44 241 256 N Carbamylation
K.CD(+21.98)IDIR.K 0.89 3.84 378.6712 72.34 - 75.58 2 2.2E4 74.12 287 292 N Sodium adduct
K.A(+42.01)GFAGDDAPR.A 0.09 5.52 509.7307 51.16 - 53.12 2 2.2E4 52.05 21 30 N Acetylation (Protein N-term)
K.E(+43.01)ITALAPSTMK.I 1.43 10.90 1204.6299 96.41 - 99.28 1 2.1E4 97.75 318 328 N Carbamylation
K.QEYDEAGPSIVHRK.C 1.09 11.29 814.9096 38.57 - 46.15 2 2E4 43.33 362 375 N
R.A(+43.01)VFPSIVGRPR.H 0.05 1.39 621.3619 99.34 - 101.91 2 2E4 100.45 31 41 N Carbamylation
K.SYE(+21.98)LPDGQVITIGNER.F 0.70 7.73 906.9447 104.88 - 108.35 2 1.9E4 106.42 241 256 N Sodium adduct
K.CDIDIRK.D 0.28 3.75 431.7315 35.29 - 43.68 2 1.7E4 40.33 287 293 N
Y.ELPDGQVITIGNER.F 0.74 0.82 770.9024 83.04 - 87.20 2 1.7E4 84.85 243 256 N
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 1.28 2.63 1053.4941 130.72 - 131.99 3 1.7E4 131.14 259 286 N Carbamidomethylation
R.D(+43.01)LTDYLMK.I 1.62 39.41 521.2515 117.02 - 119.05 2 1.6E4 118.15 186 193 N Carbamylation
R.MQKEITALAPSTMK.I 0.72 2.90 516.9429 66.14 - 68.49 3 1.6E4 67.42 315 328 N
K.C(+43.01)DIDIR.K 0.39 1.73 389.1850 47.84 - 54.30 2 1.6E4 50.13 287 292 N Carbamylation
R.A(+43.01)VFPSIVGRPR.H 1.44 10.51 414.5766 99.30 - 102.81 3 1.5E4 101.11 31 41 N Carbamylation
L.ASLSTFQQMWISK.Q 0.62 6.45 763.8878 121.29 - 123.50 2 1.5E4 121.95 349 361 N
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 1.09 3.52 779.1155 132.28 - 133.69 4 1.4E4 132.73 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
K.I(+43.01)IAPPER.K 0.46 9.08 419.7466 71.57 - 74.74 2 1.4E4 73.51 331 337 N Carbamylation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.80 0.73 851.9112 130.83 - 132.21 4 1.4E4 131.20 257 286 N
K.YPIEHGIITNWDDMEK.I 0.60 0.75 654.2893 98.11 - 103.47 3 1.3E4 100.11 71 86 N
K.E(-18.01)ITALAPSTMK.I 0.50 1.76 572.3129 93.03 - 97.67 2 1.3E4 95.19 318 328 N Pyro-glu from E
R.FRC(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.71 0.73 866.1681 129.58 - 131.30 4 1.1E4 130.11 257 286 N Carbamidomethylation
Y.VALDFENEMATAASSSSLEK.S 0.83 3.14 1050.4943 112.47 - 115.95 2 1E4 113.67 221 240 N
K.I(+43.01)WHHTFYNELR.V 0.61 7.93 779.8879 106.52 - 108.85 2 1E4 107.55 87 97 N Carbamylation
R.G(+43.01)YSFVTTAER.E 0.26 0.47 587.2926 84.31 - 88.66 2 9.7E3 86.48 199 208 N Carbamylation
V.T(+42.01)TAER.E 0.35 0.31 619.2796 37.34 - 41.75 1 9.4E3 39.64 204 208 N Acetylation (Protein N-term)
R.C(+43.01)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.76 1.69 1048.8210 130.83 - 132.02 3 8.6E3 131.35 259 286 N Carbamylation
L.STFQQMWISK.Q 0.10 5.65 628.3149 94.45 - 97.31 2 8.4E3 95.90 352 361 N
C.D(+42.01)DDETTALVCDNGSGLVK.A Y 0.63 1.88 947.4284 95.81 - 99.26 2 8.3E3 97.71 3 20 Y Acetylation (Protein N-term)
R.LDLAGRDLTDYLMK.I 0.76 5.29 812.4260 117.91 - 119.71 2 7.5E3 118.85 180 193 N
R.D(+43.01)LTDYLMK.I 0.79 3.19 1041.4927 117.22 - 121.52 1 7.4E3 118.63 186 193 N Carbamylation
R.K(+43.01)DLYANNVLSGGTTMYPGIADR.M 0.82 5.65 800.3936 110.00 - 111.58 3 6.2E3 110.91 293 314 N Carbamylation
K.D(+43.01)LYANNVLSGGTTMYPGIADR.M 0.27 6.76 757.6980 125.99 - 127.80 3 6E3 126.64 294 314 N Carbamylation
R.F(+43.01)RCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.20 1.49 862.6651 129.95 - 131.56 4 5.9E3 130.38 257 286 N Carbamylation
R.CP(+15.99)E(+14.02)T(-18.01)LFQPSFIGMESAGIHETAYNSIMK.C 0.09 5.81 779.1235 132.52 - 133.76 4 5.3E3 133.09 259 286 N Hydroxylation [P]; Methylation (DE); Phospho neutral loss (ST)
R.MQKEITALAPSTMK.I 0.40 3.31 774.9105 66.11 - 68.83 2 5E3 67.33 315 328 N
Y.ANNVLSGGTTMYPGIADR.M 0.43 2.21 918.9269 85.64 - 89.50 2 4.8E3 87.46 297 314 N
K.SYELPDGQVITIGNER.F 0.06 4.04 597.6384 95.83 - 99.51 3 3.9E3 97.66 241 256 N
K.I(+43.01)KIIAPPER.K 1.06 2.15 360.5597 52.94 - 60.32 3 3.8E3 56.03 329 337 N Carbamylation
R.CPETLFQPSFIGMESAGIHETAYNSIMK.C 0.14 2.94 1034.4923 131.19 - 133.49 3 3.8E3 132.16 259 286 N
K.S(+43.01)YELPDGQVITIGNER.F 0.15 5.63 917.4638 119.06 - 122.81 2 3.5E3 121.19 241 256 N Carbamylation
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.13 5.70 790.3885 130.81 - 131.62 4 3E3 131.08 259 286 N Carbamidomethylation
K.I(+43.01)LTER.G 0.26 6.59 337.6969 71.13 - 74.54 2 2.8E3 72.83 194 198 N Carbamylation
R.FRCPETLFQPSFIGMESAGIHETAYNSIMK.C 0.03 5.43 851.9228 130.76 - 131.86 4 2.8E3 131.12 257 286 N
R.G(+43.01)ILTLK.Y 0.42 0.53 344.2257 93.31 - 99.17 2 2.5E3 94.90 65 70 N Carbamylation
R.C(+57.02)PETLFQPSFIGMESAGIHETAYNSIMK.C 0.02 1.14 1053.4894 130.94 - 133.77 3 836.5 132.28 259 286 N Carbamidomethylation
K.DLYANNVLSGGTTMYPGIADR.M 0.03 1.40 1114.5380 111.58 - 115.72 2 354 112.78 294 314 N
total 129 peptides