| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Candidates Quality Significance (-10lgP) m/z RT range z Avg. Area Sample Profile Group Profile RT mean Start End Used PTM
K.GILAADESTGSVAK.R 2.41 1.64 659.8485 52.87 - 60.83 2 6.3E5 56.18 29 42 N
R.QLLFTADDR.M 2.27 0.92 539.7832 77.18 - 81.58 2 5.8E5 78.90 61 69 N
K.LFPEYLK.G Y 2.56 2.31 455.2587 86.09 - 90.66 2 5.1E5 87.94 93 99 Y
R.ALQASALK.A 2.49 2.24 401.2463 38.88 - 48.55 2 4.9E5 42.95 305 312 N
K.ELSDIAQR.I 2.48 2.30 466.2468 40.57 - 50.77 2 4.4E5 44.82 15 22 N
R.LAIIENANVLAR.Y Y 2.33 0.28 648.8871 97.45 - 101.09 2 4.4E5 98.86 162 173 Y
K.ITPTTPSR.L Y 1.85 0.12 436.7470 31.53 - 39.04 2 3.9E5 33.45 154 161 Y
R.NMVVGIK.V Y 2.15 2.77 380.7244 52.81 - 60.49 2 3.9E5 56.02 102 108 N
M.PHSYPFLTPEQK.K Y 1.48 1.41 481.9156 68.19 - 75.00 3 3.4E5 70.68 2 13 N
K.GVVPLAGTNGETTTQGLDGLYER.C 2.47 2.38 783.3984 103.77 - 107.55 3 2.9E5 105.07 112 134 N
K.RFQSINAENTEENR.R 2.04 0.98 569.9413 37.44 - 48.35 3 2.3E5 42.30 43 56 N
K.FSNQEIAMATVTALR.R Y 2.02 0.90 826.4277 111.29 - 114.79 2 2E5 112.53 244 258 N
R.FQSINAENTEENR.R 1.83 2.10 776.3580 41.72 - 53.09 2 2E5 46.80 44 56 N
K.DGADFAK.W 1.60 0.32 362.1717 32.74 - 38.98 2 1.8E5 34.48 141 147 N
K.FSNQEIAMATVTALR.R Y 2.10 0.61 551.2900 111.35 - 115.15 3 1.7E5 112.53 244 258 N
R.ALANNQACQGK.Y Y 1.44 2.06 559.2781 29.52 - 34.02 2 1.7E5 30.63 332 342 N
M.PHSYPFLTPEQK.K Y 1.23 0.68 722.3702 68.31 - 75.24 2 1.6E5 70.72 2 13 N
K.ACQEEFMK.R Y 2.00 2.64 493.2118 45.65 - 55.76 2 1.5E5 49.79 323 330 N
R.ALQASALK.A 2.12 1.50 801.4857 38.91 - 48.55 1 1.2E5 42.95 305 312 N
K.AC(+57.02)QEEFMK.R Y 1.23 1.20 521.7245 40.22 - 52.50 2 1.1E5 46.56 323 330 N Carbamidomethylation
K.DGADFAK.W 0.97 0.10 723.3347 32.60 - 39.44 1 1E5 34.50 141 147 N
K.VLAALYK.A Y 1.82 1.23 389.2478 59.98 - 66.86 2 9.8E4 62.81 209 215 N
K.GVVPLAGTNGETTTQGLDGLYER.C 2.01 3.49 1174.5911 103.80 - 106.89 2 9.6E4 105.06 112 134 N
K.KELSDIAQR.I 1.69 0.10 530.2946 36.15 - 45.86 2 7.3E4 40.08 14 22 N
K.FSNQEIAMATVTALRR.T Y 1.18 0.15 603.3221 102.77 - 106.12 3 7.2E4 104.17 244 259 N
K.A(+43.01)CQEEFMK.R Y 1.75 2.28 514.7146 44.36 - 54.06 2 7E4 48.45 323 330 N Carbamylation
K.VDKGVVPLAGTNGETTTQGLDGLYER.C 1.94 0.81 897.4612 95.90 - 99.14 3 6.9E4 97.39 109 134 N
R.Q(-17.03)LLFTADDR.M 1.77 2.54 531.2677 111.54 - 115.40 2 6.3E4 113.17 61 69 N Pyro-glu from Q
R.ALANNQAC(+57.02)QGK.Y Y 1.40 0.40 587.7885 28.07 - 30.97 2 5.6E4 29.35 332 342 N Carbamidomethylation
K.TDN(+.98)GKLFPEYLK.G Y 1.26 27.48 475.9114 86.83 - 90.66 3 5.5E4 89.12 88 99 N Deamidation (NQ)
R.FQSINAENTEENRR.L 1.51 3.10 854.4094 37.34 - 48.32 2 5E4 42.27 44 57 N
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK.F Y 0.85 0.85 615.1104 80.36 - 84.81 5 4.6E4 82.46 216 243 N
R.IVAPGK.G 1.85 0.78 584.3787 30.18 - 34.51 1 4.6E4 31.27 23 28 N
K.ELSDIAQR.I 1.78 0.71 931.4864 40.36 - 50.38 1 4.6E4 44.81 15 22 N
R.CQYVTEK.V 1.08 0.28 435.7070 32.28 - 36.12 2 4.5E4 33.63 202 208 N
R.MNPCIGGVILFHETMYQK.T Y 1.17 0.97 694.3437 128.35 - 131.89 3 4.3E4 129.34 70 87 N
K.GVVPLAGTNGE(+21.98)TTTQGLDGLYER.C 1.72 4.39 790.7247 103.67 - 106.86 3 4E4 105.07 112 134 N Sodium adduct
K.G(+43.01)ILAADESTGSVAK.R 1.16 0.62 681.3512 77.85 - 81.67 2 3.9E4 79.34 29 42 N Carbamylation
K.LFPEYLK.G Y 1.77 2.20 909.5098 84.89 - 90.60 1 3.8E4 87.94 93 99 N
K.KELSDIAQR.I 1.39 0.48 353.8656 36.18 - 45.86 3 3.6E4 39.89 14 22 N
K.YVSSAASTAGAESLFVANHAY Y 1.25 4.21 706.0095 104.05 - 107.50 3 3.6E4 105.80 343 363 N
K.AC(+57.02)QEEFMK.R Y 0.19 3.21 521.7232 41.23 - 53.16 2 3.4E4 44.57 323 330 N Carbamidomethylation
R.FQSINAENTEENR.R 1.58 2.91 517.9084 42.16 - 52.35 3 3.3E4 46.80 44 56 N
M.P(+43.01)HSYPFLTPEQK.K Y 0.25 7.27 743.8651 85.92 - 89.09 2 3E4 87.62 2 13 N Carbamylation
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.95 0.58 629.9228 124.17 - 127.55 5 3E4 125.69 174 201 N
K.GVVPLAGTNGETTT(-18.01)QGLDGLYER.C 1.56 0.07 777.3933 106.75 - 109.55 3 2.7E4 108.08 112 134 N Phospho neutral loss (ST)
M.P(+43.01)HSYPFLTPEQK.K Y 0.06 5.57 743.8803 86.17 - 88.08 2 2.5E4 87.02 2 13 N Carbamylation
R.Q(+43.01)LLFTADDR.M 0.37 0.21 561.2852 101.70 - 105.06 2 2.2E4 103.32 61 69 N Carbamylation
R.LAIIENANVLAR.Y Y 0.44 0.30 648.8869 98.73 - 104.74 2 2.1E4 100.43 162 173 N
K.YVSSAASTAGAESLFVANHAY Y 1.07 3.02 1058.5054 104.08 - 107.52 2 2.1E4 105.74 343 363 N
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 1.05 0.91 797.9042 120.79 - 124.53 4 2E4 122.46 174 201 N Carbamylation
K.KDGADFAK.W 0.37 0.44 426.2105 29.08 - 34.27 2 1.9E4 31.86 140 147 N
K.ALSDHHVYLEGTLLKPNMVTPGHSC(+57.02)SHK.F Y 0.79 0.97 626.5153 79.81 - 83.34 5 1.9E4 81.69 216 243 N Carbamidomethylation
K.GILAADESTGSVAK.R 0.20 0.96 659.8450 55.82 - 64.58 2 1.9E4 58.74 29 42 N
R.N(+43.01)MVVGIK.V Y 0.61 0.23 402.2264 72.31 - 75.38 2 1.9E4 73.70 102 108 N Carbamylation
K.ELSDIAQR.I 0.10 3.40 466.2603 44.88 - 49.81 2 1.8E4 46.37 15 22 N
R.QLLFTADDR.M 1.48 1.12 1078.5549 77.07 - 81.48 1 1.8E4 78.90 61 69 N
K.TDN(+.98)GKLFPEYLK.G Y 0.31 4.23 713.3660 86.35 - 90.57 2 1.7E4 88.14 88 99 N Deamidation (NQ)
H.SYPFLTPEQK.K Y 0.19 4.20 605.3050 78.43 - 85.53 2 1.5E4 82.40 4 13 N
R.Q(-17.03)LLFTADDR.M 1.13 0.10 1061.5287 111.74 - 114.84 1 1.5E4 113.16 61 69 N Pyro-glu from Q
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK.F Y 0.30 0.36 768.6337 80.53 - 84.51 4 1.4E4 82.40 216 243 N
K.ALSDHHVYLEGTLLKPN.M 0.16 0.59 636.3442 82.81 - 87.33 3 1.4E4 85.52 216 232 N
R.LAIIENANVLAR.Y Y 1.53 1.71 432.9271 97.52 - 100.73 3 1.3E4 98.86 162 173 N
R.ALANNQAC(+45.99)QGK(+43.01).Y Y 0.50 0.54 603.7862 29.08 - 33.32 2 1.3E4 30.64 332 342 N Beta-methylthiolation; Carbamylation
K.ALSDHHVYLEGTLLKPNMVTPGHSCSHK(+43.01).F Y 0.18 6.17 623.7081 80.20 - 83.84 5 1.2E4 82.38 216 243 N Carbamylation
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLKR.C Y 0.45 0.40 641.3289 119.25 - 121.80 5 1.2E4 120.21 174 201 N Carbamidomethylation
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLKR.C Y 0.67 0.50 801.4091 118.69 - 121.37 4 1.1E4 120.05 174 201 N Carbamidomethylation
K.G(+43.01)VVPLAGTNGETTTQGLDGLYER.C 0.70 0.89 797.7267 117.18 - 120.54 3 9.9E3 118.80 112 134 N Carbamylation
H.GIVPIVEPEILPDGDHDLK.R Y 0.84 6.41 686.0376 118.11 - 120.66 3 9.2E3 119.35 182 200 N
R.L(+43.01)AIIENANVLAR.Y Y 1.47 1.65 670.3878 133.53 - 134.42 2 9E3 133.79 162 173 N Carbamylation
R.C(+57.02)QYVTEK.V 0.28 0.34 464.2192 31.01 - 36.60 2 8.7E3 33.24 202 208 N Carbamidomethylation
K.I(+43.01)TPTTPSR.L Y 0.21 0.69 458.2546 48.91 - 56.03 2 8E3 51.06 154 161 N Carbamylation
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLK.R Y 0.39 3.40 758.8752 126.49 - 128.85 4 8E3 128.06 174 200 N Carbamylation
R.F(+43.01)QSINAENTEENR.R 0.29 0.21 797.8614 71.91 - 77.68 2 7E3 74.00 44 56 N Carbamylation
R.YASICQMHGIVPIVEPEILPDGDHDLK.R Y 0.35 4.78 748.1224 128.93 - 130.01 4 6.4E3 129.48 174 200 N
K.ALSDHHVYLEGTLLKPNMVTPGHSC(+57.02)SHK.F Y 0.14 0.50 782.8906 79.71 - 83.24 4 6.2E3 81.24 216 243 N Carbamidomethylation
K.ALSDHHVYLEGTLLKPNMVTPGH.S Y 0.49 2.63 633.0775 94.06 - 96.86 4 5.7E3 95.32 216 238 N
K.YVSSAASTAGAESLFVANHAY Y 0.09 5.60 706.0218 105.34 - 107.86 3 5.1E3 106.56 343 363 N
K.F(+43.01)SNQEIAMATVTALR.R Y 0.68 0.60 847.9315 131.30 - 132.10 2 4.6E3 131.65 244 258 N Carbamylation
K.FSNQEIAMATVTALRR.T Y 0.78 0.62 904.4762 102.87 - 105.44 2 4.5E3 103.97 244 259 N
R.C(+43.01)QYVTEK.V 0.05 5.30 457.2257 33.64 - 35.89 2 4.4E3 35.04 202 208 N Carbamylation
R.YASIC(+57.02)QMHGIVPIVEPEILPDGDHDLK.R Y 0.22 4.69 762.3758 125.77 - 127.92 4 4.1E3 126.93 174 200 N Carbamidomethylation
K.YVSSAASTAGAESLFVANHAY Y 0.04 1.51 1058.5035 103.41 - 106.32 2 3.1E3 104.33 343 363 N
K.L(+43.01)FPEYLK.G Y 0.67 1.18 476.7633 129.09 - 130.24 2 3E3 129.75 93 99 N Carbamylation
R.YASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.18 1.63 1049.1935 124.66 - 126.25 3 1.9E3 125.76 174 201 N
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.14 0.59 797.9069 130.99 - 132.15 4 1.8E3 131.60 174 201 N Carbamylation
K.V(+43.01)LAALYK.A Y 0.88 2.45 410.7496 128.72 - 129.71 2 1.1E3 129.36 209 215 N Carbamylation
R.Y(+43.01)ASICQMHGIVPIVEPEILPDGDHDLKR.C Y 0.03 5.28 797.8907 121.96 - 124.55 4 856.3 123.10 174 201 N Carbamylation
total 88 peptides